KEGG   Delphinapterus leucas (beluga whale): 111181305
Entry
111181305         CDS       T05885                                 

Gene name
RIPK1
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 1 isoform X1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04210  Apoptosis
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04668  TNF signaling pathway
dle05132  Salmonella infection
dle05160  Hepatitis C
dle05163  Human cytomegalovirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111181305 (RIPK1)
   04668 TNF signaling pathway
    111181305 (RIPK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111181305 (RIPK1)
   04217 Necroptosis
    111181305 (RIPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111181305 (RIPK1)
   04621 NOD-like receptor signaling pathway
    111181305 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    111181305 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    111181305 (RIPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111181305 (RIPK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111181305 (RIPK1)
   05160 Hepatitis C
    111181305 (RIPK1)
   05163 Human cytomegalovirus infection
    111181305 (RIPK1)
   05169 Epstein-Barr virus infection
    111181305 (RIPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111181305 (RIPK1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111181305 (RIPK1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   111181305 (RIPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Death RHIM RIO1 Kdo
Other DBs
NCBI-GeneID: 111181305
NCBI-ProteinID: XP_022442244
UniProt: A0A2Y9PAG9
LinkDB
Position
Unknown
AA seq 687 aa
MSLDDIRMSSTEFLRQEDLDSGGFGKVSLCLHSSHGLVVLKKVYTGPKRTEYDEALLEDG
RMMHRLRHSRVVKLLGVIMEDGNYSLVMEYVEKGDLMRALKAQISIPLSVKGRIIMETIE
GMRYLHGEGVIHKDLKPENILIDGDFHIKIADLGLASLKTWSELMKEELTAQRRGNSTTK
NGGTLHYMAPEHLNDVSSRPSEKSDVFSFAIVLWAVFANKEPYENAPCEQQLILCIKSGG
RPDVEDITGQCPREAVSIMKQCWAVNPEDRPTFAAPGTHRSTFCLSEFGYSGTSCIEEKF
RPFYLNQLEEHVEEDVKSLKKEYLGQNEIVKRMKSLQIGCVAMSPSRSNSAAEQPSSLHS
SQGFGLGPVEDSWFAPAPEQQQQQEEDLLLHSKLQEEANYHLYGSRMDRHTEEQPRQNVA
DRRQEERRRRVSHDPFAQQRPYENAQNPGLKGLAYSGATNHGSAVQQPAGLTSQPQLLHW
RNGLCTSLGFGARPVDLRTAGPGVWDGPNPGHMPSLYKTPVPETNLLGNTPTIPFSSFPS
RDESLKYGIYNSFGVQIGNNNYMEIGGMSPLVLDSTYMNLKEDPASKYQDIFDNTTSLTD
KHLDPVRENLGRQWKDCARKLGFSQSQIDEIDHDYERDGLKEKVYQMLQKWLMREGSKGA
TVGKLAWALYQCSRVDLLSHLTHSSQN
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgtccttggatgacattaggatgagctctactgaattcctgaggcaggaggacctggac
agtgggggcttcgggaaggtgtctctgtgtttacacagctcccatggactcgtggtcctg
aagaaggtgtacacgggccccaagcgcaccgagtacgatgaggccctcctggaggacggc
aggatgatgcacaggctgcggcacagccgcgtggtgaagctgctgggcgtcatcatggag
gacgggaactactcgctggtgatggagtacgtggagaagggcgacctcatgcgcgcgctc
aaggcccagatcagtatccctctctctgtgaaaggaagaataattatggagaccattgaa
ggaatgcgctacttacacggagaaggtgtgatacacaaggacctcaagcctgaaaatatc
ctcatcgatggtgactttcacattaagatagctgaccttggccttgcctcccttaagacg
tggagtgagctgatgaaagaggagcttactgcgcagaggagaggaaacagcaccacgaag
aacggcggcaccctccactacatggcccccgagcacctgaacgacgtcagctcgaggccc
tctgagaagtcggacgtgttcagcttcgccatagtgctctgggccgtctttgccaacaag
gagccgtatgaaaacgctccctgtgagcagcagctgatcctgtgcattaagtctgggggc
aggccggacgtggaggacatcacggggcagtgcccgcgggaggccgtcagcatcatgaag
cagtgctgggcggtgaatccagaagatcggccgacgtttgctgcccctggcacccatcgt
tctactttctgtctctctgaatttggctactccgggacctcatgcattgaagagaaattt
aggcctttttatttaaatcaattagaagaacatgtagaagaggatgtgaagagtttaaag
aaagagtatctgggccaaaatgaaattgtaaagagaatgaagtctctccaaattggttgc
gtagcaatgtctccaagcaggtcaaattcagccgcagaacagcccagttcgctgcacagt
tcacagggattcgggctgggtcctgtggaggactcctggttcgctcccgcccccgagcag
cagcagcagcaggaggaggacctcctgctgcacagtaaactccaggaggaggccaactac
catctttacggcagccgcatggacaggcatacggaagagcagcccagacagaatgtggct
gacaggagacaggaagagaggagacggagggtctcccatgacccttttgcacagcagaga
ccttatgagaatgctcagaacccagggctgaaaggccttgcttattccggtgcaaccaat
catggtagtgcggtacagcaaccagcagggctaaccagccagccccagttactgcactgg
agaaatggattgtgtacatcactcggttttggagcaagaccagtggatctgagaaccgca
ggtccaggagtttgggatgggccaaatccaggccacatgccaagcctgtataaaactcca
gtgcctgagaccaacctactgggaaacacacccaccattccattcagctccttcccatca
agagatgagtctttaaaatatggcatatacaacagttttggcgttcagattggaaacaat
aattatatggagattggcggaatgagtccattggtactggacagcacgtacatgaacttg
aaagaagacccagcttctaagtaccaagatatctttgataataccactagtctgactgat
aaacacctggacccagtcagagaaaatctgggcaggcagtggaaagactgtgcccgtaag
ctgggcttctcccaatctcagattgatgaaattgaccatgactatgagcgagatggacta
aaagaaaaggtttaccagatgctccaaaagtggctgatgagggaaggcagcaagggggcc
accgtggggaagctggcctgggcgctctaccagtgttccagggtagacctgctgagccac
ttgacacacagcagccagaactaa

DBGET integrated database retrieval system