KEGG   Delphinapterus leucas (beluga whale): 111181753Help
Entry
111181753         CDS       T05885                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04062  Chemokine signaling pathway
dle04070  Phosphatidylinositol signaling system
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04270  Vascular smooth muscle contraction
dle04310  Wnt signaling pathway
dle04371  Apelin signaling pathway
dle04540  Gap junction
dle04611  Platelet activation
dle04621  NOD-like receptor signaling pathway
dle04713  Circadian entrainment
dle04720  Long-term potentiation
dle04723  Retrograde endocannabinoid signaling
dle04724  Glutamatergic synapse
dle04725  Cholinergic synapse
dle04726  Serotonergic synapse
dle04728  Dopaminergic synapse
dle04730  Long-term depression
dle04750  Inflammatory mediator regulation of TRP channels
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04922  Glucagon signaling pathway
dle04924  Renin secretion
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04929  GnRH secretion
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04934  Cushing syndrome
dle04961  Endocrine and other factor-regulated calcium reabsorption
dle04970  Salivary secretion
dle04971  Gastric acid secretion
dle04972  Pancreatic secretion
dle04973  Carbohydrate digestion and absorption
dle05010  Alzheimer disease
dle05016  Huntington disease
dle05142  Chagas disease (American trypanosomiasis)
dle05143  African trypanosomiasis
dle05146  Amoebiasis
dle05163  Human cytomegalovirus infection
dle05200  Pathways in cancer
Module
dle_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111181753 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111181753 (PLCB2)
   04310 Wnt signaling pathway
    111181753 (PLCB2)
   04371 Apelin signaling pathway
    111181753 (PLCB2)
   04020 Calcium signaling pathway
    111181753 (PLCB2)
   04070 Phosphatidylinositol signaling system
    111181753 (PLCB2)
   04072 Phospholipase D signaling pathway
    111181753 (PLCB2)
   04071 Sphingolipid signaling pathway
    111181753 (PLCB2)
   04022 cGMP-PKG signaling pathway
    111181753 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111181753 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111181753 (PLCB2)
   04621 NOD-like receptor signaling pathway
    111181753 (PLCB2)
   04062 Chemokine signaling pathway
    111181753 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    111181753 (PLCB2)
   04922 Glucagon signaling pathway
    111181753 (PLCB2)
   04929 GnRH secretion
    111181753 (PLCB2)
   04912 GnRH signaling pathway
    111181753 (PLCB2)
   04915 Estrogen signaling pathway
    111181753 (PLCB2)
   04921 Oxytocin signaling pathway
    111181753 (PLCB2)
   04926 Relaxin signaling pathway
    111181753 (PLCB2)
   04918 Thyroid hormone synthesis
    111181753 (PLCB2)
   04919 Thyroid hormone signaling pathway
    111181753 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    111181753 (PLCB2)
   04916 Melanogenesis
    111181753 (PLCB2)
   04924 Renin secretion
    111181753 (PLCB2)
   04925 Aldosterone synthesis and secretion
    111181753 (PLCB2)
   04927 Cortisol synthesis and secretion
    111181753 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111181753 (PLCB2)
   04270 Vascular smooth muscle contraction
    111181753 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    111181753 (PLCB2)
   04971 Gastric acid secretion
    111181753 (PLCB2)
   04972 Pancreatic secretion
    111181753 (PLCB2)
   04973 Carbohydrate digestion and absorption
    111181753 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    111181753 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    111181753 (PLCB2)
   04725 Cholinergic synapse
    111181753 (PLCB2)
   04728 Dopaminergic synapse
    111181753 (PLCB2)
   04726 Serotonergic synapse
    111181753 (PLCB2)
   04720 Long-term potentiation
    111181753 (PLCB2)
   04730 Long-term depression
    111181753 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    111181753 (PLCB2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111181753 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111181753 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111181753 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111181753 (PLCB2)
   05016 Huntington disease
    111181753 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111181753 (PLCB2)
   04934 Cushing syndrome
    111181753 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111181753 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111181753 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    111181753 (PLCB2)
   05143 African trypanosomiasis
    111181753 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111181753 (PLCB2)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     111181753 (PLCB2)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    111181753 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    111181753 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y C2 EF-hand_like Gp58 AAA_13
Motif
Other DBs
NCBI-GeneID: 111181753
NCBI-ProteinID: XP_022443190
UniProt: A0A2Y9PAZ4
LinkDB All DBs
Position
Unknown
AA seq 1211 aa AA seqDB search
MTPGTERPLLGAARPRDLLLEQHREGSPEQEVLRHRETTIASPVILRVDPKGYYLYWTYQ
NKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTF
HNFVSYKENVGKDWAEDVLALAKHPLMANASRSTFLDKSLVKLKMQLNPEGKIPVKNFFQ
MFPADRKRVEAALSACHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKA
KPYMTKEHLAKFINQKQRDSRLNSLLFPLARPDQVQGLIDKYEPRGINVQRGQLSPEGMV
WLLCGPENSVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAG
CRCVELDCWKGKPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVD
SPRQQAKMAEYCRTIFGDMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNQFSGPPA
PSQEPGGEAEGSGPPNVPVGEDTVLMELYVAVWAGEEGAELEEEEVEEEEEESGSLDEEG
MKKMQSDEGTAGLEVTAYKEMSSLVNYVQPTKFISFESSARELACGGEKNRSYVISSFTE
LKAYDLLSKSSVQFVDYNKRQMSRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLP
MQQNMALFEFNGQSGYLLKHEFMRRLDKQFNPFSVDRIDVVVATTLSITVISGQFLSERS
VRTYVEVELFGLPGDPKRRYRTKLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMED
GNKFLGHRIIPINALNSGYHHLCLHSESNMPLTMPALFVFLEMKDYVPDTWADLTVALAN
PIKFFNAHDKKSVKLKEAMGGLPENPFPLGSPVARQVNGASALTSNGSAAAGAKAREEAT
KEAAAEPRTASLEELRELKSVVKLQRRHEKELRELERRGARRWEELLQRRAAQRAELRPP
GAGGGGEGRGRKLGPGKGSSIKRTPPGEDPAGSAPAEGPEGAGARLRELRDRLELELLQQ
GEEQCECVLRCRAQQVAEQMTKMMELAREKQAAELKTLKETLETDTKEVKKKLEAKRLDR
IQAMMKVTTDKMAQERLKREINNSHIQEVVQVLKQMTENLERHQEKLEEKQAACLEQIRE
MEKQFQQEALAQYEAKMKGLEVEVKESVRTYLRACLPSAEEDKPERPCRVSRELCEQDAL
TEKTDAQETLL
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atgacccctgggacggagaggcccctgctcggggcggccaggcctcgggacctgcttctt
gagcagcacagagaaggaagccctgagcaggaagtgctgaggcaccgggaaacaacaata
gcctccccggttatcctccgtgtggatcccaagggctactacttgtactggacgtatcag
aataaggagatggagtttctggatatcaccagcatccgggacacccgctttgggaagttt
gccaagatgcccaagagccagaagctccgggatgtcttcaacatggactttcctgacaac
aacttcctgctgaagacgctcaccgtggtgtctggccccgacatggtggacctcaccttc
cataacttcgtctcctacaaagagaacgtgggcaaggactgggctgaagatgtcctggct
ctggccaagcacccgctgatggccaacgcctcccgcagcaccttcctggacaagagcctg
gtgaaactcaagatgcagctcaaccctgaaggaaagattcctgtgaagaattttttccag
atgtttcctgctgaccgcaagcgggtggaagctgcccttagcgcctgccacctcccaaaa
ggcaagaatgatgccatcaatcccgaggacttcccagaatccgtctacaagagtttcctc
atgagcctttgtcctcggccagaaatagatgagatcttcacttcctaccacgccaaggcc
aaaccctacatgactaaggagcacctggccaaattcatcaaccagaaacagcgcgactcc
aggctcaactccctgctgttcccgcttgcgcggcctgaccaggtgcagggcctcatcgac
aagtacgagcccagaggcatcaacgtgcagaggggccagctgtcccccgagggcatggta
tggttactctgtgggccagagaacagcgtgctggcccaggacaagctgctgctgcaccac
gacatgacgcagccgctcaaccattacttcatcaactcctcccacaacacctacctgaca
gccggccagttctcaggcctttcctctgccgagatgtaccgccaggtgctgctggcgggc
tgccgctgcgtggagctggactgctggaaggggaagccccctgacgaggagcccattatc
acccacggcttcaccatgaccacagacatctatttcaaggaagcaattgaagctattgca
gaaagtgcctttaagacctccccttatccggtcatcctgtcgtttgaaaaccatgtggac
tcaccccgccaacaggctaagatggctgagtactgccgaacgatatttggggatatgctg
ctcacagagccactggaaaagttcccactgaaaccaggcatccccctgcccagccctgag
gatctccgaggcaagatcctcatcaaaaacaagaagaaccagttttctggtcccccagcc
cccagccaggagccgggtggggaggctgaggggagcggcccacccaatgtccctgtgggt
gaggacacagtgctgatggagctgtatgtggcagtgtgggctggtgaggaaggggctgag
ctggaggaggaggaggtggaagaggaagaggaggagtcgggaagcctggatgaagaaggg
atgaagaagatgcagtcagatgagggcacagcgggcctggaggtgacggcttacaaggag
atgtccagcctagtcaattatgtccaacccaccaagttcatctccttcgagtcctctgcc
cgtgagttagcatgcggtggtgagaagaaccgaagttatgtcatttcctccttcacggag
ctcaaggcttacgacctgctctccaagtcctcagtgcagtttgtggactacaacaagcgc
cagatgagccgcatctaccccaagggcacccgcatggactcctccaactacatgccccag
atgttctggaatgctggttgccagatggttgccctcaacttccagacgatggacctgccc
atgcagcagaacatggcgctctttgagttcaacgggcagagtggctacctcctcaagcat
gagttcatgcgccggttggacaagcagttcaaccccttctcggtggaccgcatcgacgtg
gtggtagccaccaccctttccattacggtgatctctgggcagttcctgtcagaacgcagt
gtgcgcacctatgtggaagtggagctgtttggccttcctggggaccccaagaggcgctat
cgcaccaagctgtcacccagtaccaattccatcaatcctgtctggaaggaggagcccttt
gtctttgaaaagatcttgatgcctgagctggcctccctcagggtggctgtgatggaggac
ggcaacaagtttcttggacaccgcatcatccccatcaatgccctgaattctggataccac
catctgtgcctgcacagcgagagcaacatgccgctcaccatgcctgcactctttgtcttc
ctggagatgaaggactatgtacctgacacctgggcagatctcacggtggccctcgccaat
cccatcaagttcttcaatgctcatgataagaagtctgtgaagctcaaggaagccatggga
ggcctgcctgagaatcccttccctctcgggagtccagttgcccgccaggtcaatggggca
tcagctttaacgagcaacgggtcagcagcagccggggccaaggccagggaggaggccacg
aaagaagctgcggcagagccgcggaccgctagcctggaggagctgcgggagctgaagagc
gtcgtgaagctgcagcggcggcacgagaaggagctgcgggagctggagcggcgcggcgcg
cgacgctgggaggagctgctgcagaggcgcgcggcgcagcgggccgagctccggccgccg
ggcgctgggggcggcggcgagggccggggccgcaagctcggcccggggaaaggctccagc
ataaagaggaccccgccgggcgaggaccccgccgggtcggcgccggccgaaggccccgag
ggcgcgggcgcgcgtctgcgagagctgagggacaggctggagctggagctgctgcagcag
ggcgaggagcagtgcgagtgtgtcctgaggtgcagggcacagcaagtggccgagcaaatg
accaagatgatggagctggccagagagaaacaggctgcagagctgaagaccctcaaggag
actttggagactgacaccaaagaggtgaagaaaaagctggaggccaagaggctggatcgg
atccaggccatgatgaaggtcaccacagacaagatggctcaggagaggttgaagagagag
attaacaactcccacatccaggaggtggtgcaggtcctcaagcagatgacagagaacctg
gagaggcaccaggagaagctggaagagaagcaggcagcctgcctggaacagatccgggag
atggaaaagcagttccagcaggaggcgctggcacagtacgaggccaagatgaagggcctg
gaggtggaagtgaaggagtcggtgaggacctacctcagggcctgcttgccctctgcggag
gaggacaagcctgagaggccctgcagggtctccagggagctgtgtgagcaggatgcactc
acagagaagacagatgcccaggagaccctcctctga

DBGET integrated database retrieval system