KEGG   Delphinapterus leucas (beluga whale): 111181886
Entry
111181886         CDS       T05885                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04071  Sphingolipid signaling pathway
dle04145  Phagosome
dle04151  PI3K-Akt signaling pathway
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04520  Adherens junction
dle04530  Tight junction
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04670  Leukocyte transendothelial migration
dle04722  Neurotrophin signaling pathway
dle04810  Regulation of actin cytoskeleton
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04972  Pancreatic secretion
dle05014  Amyotrophic lateral sclerosis
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05100  Bacterial invasion of epithelial cells
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05231  Choline metabolism in cancer
dle05416  Viral myocarditis
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111181886 (RAC1)
   04014 Ras signaling pathway
    111181886 (RAC1)
   04015 Rap1 signaling pathway
    111181886 (RAC1)
   04310 Wnt signaling pathway
    111181886 (RAC1)
   04370 VEGF signaling pathway
    111181886 (RAC1)
   04071 Sphingolipid signaling pathway
    111181886 (RAC1)
   04024 cAMP signaling pathway
    111181886 (RAC1)
   04151 PI3K-Akt signaling pathway
    111181886 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111181886 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111181886 (RAC1)
   04520 Adherens junction
    111181886 (RAC1)
   04530 Tight junction
    111181886 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111181886 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111181886 (RAC1)
   04620 Toll-like receptor signaling pathway
    111181886 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    111181886 (RAC1)
   04662 B cell receptor signaling pathway
    111181886 (RAC1)
   04664 Fc epsilon RI signaling pathway
    111181886 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    111181886 (RAC1)
   04670 Leukocyte transendothelial migration
    111181886 (RAC1)
   04062 Chemokine signaling pathway
    111181886 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    111181886 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111181886 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    111181886 (RAC1)
   04380 Osteoclast differentiation
    111181886 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111181886 (RAC1)
   05205 Proteoglycans in cancer
    111181886 (RAC1)
   05203 Viral carcinogenesis
    111181886 (RAC1)
   05231 Choline metabolism in cancer
    111181886 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111181886 (RAC1)
   05212 Pancreatic cancer
    111181886 (RAC1)
   05211 Renal cell carcinoma
    111181886 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111181886 (RAC1)
   05020 Prion disease
    111181886 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    111181886 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111181886 (RAC1)
   05416 Viral myocarditis
    111181886 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111181886 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111181886 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111181886 (RAC1)
   05135 Yersinia infection
    111181886 (RAC1)
   05100 Bacterial invasion of epithelial cells
    111181886 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111181886 (RAC1)
   05163 Human cytomegalovirus infection
    111181886 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111181886 (RAC1)
   05169 Epstein-Barr virus infection
    111181886 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111181886 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111181886 (RAC1)
   04031 GTP-binding proteins [BR:dle04031]
    111181886 (RAC1)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    111181886 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    111181886 (RAC1)
  Macropinocytosis
   Ras GTPases
    111181886 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    111181886 (RAC1)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111181886 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   111181886 (RAC1)
  Exosomal proteins of colorectal cancer cells
   111181886 (RAC1)
  Exosomal proteins of bladder cancer cells
   111181886 (RAC1)
GTP-binding proteins [BR:dle04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    111181886 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 111181886
NCBI-ProteinID: XP_022443423
UniProt: A0A2Y9PL77
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctcctg
atcagttatacgaccaatgcctttcctggagagtatatccccactgtctttgacaactat
tctgccaatgttatggtggatggaaaaccggtgaatctgggcttgtgggatacagctgga
caagaagattatgaccgattacgtcccctatcctatccgcaaacggatgtattcttgatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtaccctgaa
gtgcgacaccactgtcccaacactcctatcatcctggtggggacgaaacttgatctgagg
gatgataaagacacgattgagaaactgaaggagaagaagctgacacccatcacctacccg
cagggcttggccatggccaaggagatcggtgccgtcaaatacctggagtgctcggcgctc
acgcagcgaggtcttaagacggtgtttgatgaagctatccgggcggttctctgcccgccc
cccgtcaagaagaggaagagaaaatgcctgctgttgtga

DBGET integrated database retrieval system