KEGG   Delphinapterus leucas (beluga whale): 111181978
Entry
111181978         CDS       T05885                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01523  Antifolate resistance
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04657  IL-17 signaling pathway
dle04659  Th17 cell differentiation
dle04668  TNF signaling pathway
dle04672  Intestinal immune network for IgA production
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05010  Alzheimer disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05134  Legionellosis
dle05135  Yersinia infection
dle05142  Chagas disease
dle05143  African trypanosomiasis
dle05144  Malaria
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05321  Inflammatory bowel disease
dle05323  Rheumatoid arthritis
dle05332  Graft-versus-host disease
dle05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111181978 (IL6)
   04668 TNF signaling pathway
    111181978 (IL6)
   04066 HIF-1 signaling pathway
    111181978 (IL6)
   04068 FoxO signaling pathway
    111181978 (IL6)
   04151 PI3K-Akt signaling pathway
    111181978 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111181978 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111181978 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111181978 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111181978 (IL6)
   04620 Toll-like receptor signaling pathway
    111181978 (IL6)
   04621 NOD-like receptor signaling pathway
    111181978 (IL6)
   04623 Cytosolic DNA-sensing pathway
    111181978 (IL6)
   04625 C-type lectin receptor signaling pathway
    111181978 (IL6)
   04659 Th17 cell differentiation
    111181978 (IL6)
   04657 IL-17 signaling pathway
    111181978 (IL6)
   04672 Intestinal immune network for IgA production
    111181978 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111181978 (IL6)
   05202 Transcriptional misregulation in cancer
    111181978 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111181978 (IL6)
   05321 Inflammatory bowel disease
    111181978 (IL6)
   05332 Graft-versus-host disease
    111181978 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111181978 (IL6)
   05020 Prion disease
    111181978 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    111181978 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111181978 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111181978 (IL6)
   04931 Insulin resistance
    111181978 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111181978 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111181978 (IL6)
   05135 Yersinia infection
    111181978 (IL6)
   05133 Pertussis
    111181978 (IL6)
   05134 Legionellosis
    111181978 (IL6)
   05152 Tuberculosis
    111181978 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111181978 (IL6)
   05161 Hepatitis B
    111181978 (IL6)
   05171 Coronavirus disease - COVID-19
    111181978 (IL6)
   05164 Influenza A
    111181978 (IL6)
   05162 Measles
    111181978 (IL6)
   05168 Herpes simplex virus 1 infection
    111181978 (IL6)
   05163 Human cytomegalovirus infection
    111181978 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111181978 (IL6)
   05169 Epstein-Barr virus infection
    111181978 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111181978 (IL6)
   05144 Malaria
    111181978 (IL6)
   05142 Chagas disease
    111181978 (IL6)
   05143 African trypanosomiasis
    111181978 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111181978 (IL6)
   01523 Antifolate resistance
    111181978 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111181978 (IL6)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111181978 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL23 Mod_r Sec16
Other DBs
NCBI-GeneID: 111181978
NCBI-ProteinID: XP_030615680
LinkDB
Position
Unknown
AA seq 208 aa
MNSLSTIAFSLGLLLVTATAFPTPGPLGEDFKDDTTSDRLLLTSPDKTEALIKYILGKIS
AMRKEMCEKYDKCENSKEALAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLLEYQIY
LDYLQNEYEGDKGSIEAVQISIKALAQILRQKVKNPDEVTTPDPTTNASLMNNLQSQNDD
WMKNTKIILILRSLENFLQFSLRAVRIK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaactccctctccacaatcgccttctccctggggctgctcctggtgacggctactgct
ttccctaccccgggacccctgggagaagatttcaaagatgataccacttcagacagacta
ctcctcacctctccagacaaaactgaagctctcattaagtacatcctcggcaaaatctcc
gcaatgagaaaggagatgtgtgagaagtatgacaagtgtgaaaacagcaaggaggcactg
gcagaaaacaatctgaaccttccaaaaatggcagaaaaagacggatgcttccaatctggg
ttcaatcaggagacttgcttgatgagaatcaccaccggtcttctggagtatcagatatac
ctggactacctccagaacgagtatgagggtgataagggaagcatcgaggctgtgcagatt
agcatcaaagcactggcccagatcctgaggcaaaaggtcaagaatccagatgaagtaacc
acccctgacccaactacaaatgccagcctgatgaataacctgcagtcgcagaacgatgac
tggatgaagaacacaaagattatcctcatcctgcgaagccttgagaacttcctgcagttc
agcctgagggctgttcggatcaagtag

DBGET integrated database retrieval system