KEGG   Delphinapterus leucas (beluga whale): 111182069Help
Entry
111182069         CDS       T05885                                 

Gene name
GALNT17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00512  Mucin type O-glycan biosynthesis
dle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    111182069 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dle01003]
    111182069 (GALNT17)
Enzymes [BR:dle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     111182069 (GALNT17)
Glycosyltransferases [BR:dle01003]
 O-Glycan biosynthesis
  Mucin-type
   111182069 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 111182069
NCBI-ProteinID: XP_022443841
UniProt: A0A2Y9PEX9
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPISVRSGDAFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKFSEELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNRKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNSKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAVMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgttggtgttgaacttgatcgcggtggccggc
ttcgtgctcttcctggccaagtgtcggcccatctctgtgcgcagcggagacgccttccac
gagattcggccgcgcgccgaggcggccaacctcagcgcgcacagcgccagccccatacag
gatgcggtcctgaagcgcctctcgctgctcgaggacattgtctaccggcaactgaatggt
ttatctaaatcccttgggctcattgaaggttatggtgggcggggcaaagggggccttcct
gctaccctttccccggctgaagaagagaaagccaagggaccccatgagaagtatggctac
aattcctacctcagtgaaaaaatttcactggatcgttccattccggattatcgtcccacc
aagtgtaaggagctgaagttctccgaggagctgccccagatatccatcatatttatcttc
gtgaacgaggccctgtcggtgatcctgcggtcagttcacagcgcggtcaaccacacaccg
acccacctgctgaaggaaatcatcctggtggatgacaacagtgatgaagaggagctgaag
gcccctttggaggagtatgtccacaaacgctaccctgggctggtgaaggtggtgagaaat
cgaaaaagagagggcctgatccgagctcgcatcgagggttggaaggtggccaccggccag
gtcaccggcttctttgatgcccacgtggagttcaccgctggctgggctgagccagttctc
tcgcggatacaggagaaccggaagcgggtgatcctcccgtccatcgacaacatcaaacag
gacaccttcgaggtgcagcggtatgagaactcggcccacgggtacagctgggagctgtgg
tgcatgtacatcagccccccgaaagactggtgggacgccggagacccttcccttcccatc
agaacgccagccatgattggctgctcgtttgtggtcaacaggaagttctttggtgaaatt
ggtcttctggaccctgggatggatgtgtatggaggagaaaatatcgaacttggaatcaag
gtgtggctgtgcgggggcagcatggaggtcctgccttgctcacgggtggcccacatcgag
cggaagaagaagccatacaacagcaacatcggcttctataccaagaggaatgctctccgg
gttgccgaggtctggatggacgattacaagtctcatgtgtacatagcgtggaatctgcca
ctggagaatccaggaattgacataggcgatgtctcagaaagaaaagccttaaggaaaagt
ttaaagtgtaagaatttccagtggtacctagaccacgtctacccagaaatgagaagatac
aataacaccattgcctacggggagcttcgcaacagcaaggcaaaagacgtctgcttggac
caggggccgctggagaaccacacagcaatactgtacccgtgccatggctggggaccccag
ctggcccgctacaccaaggagggcttcttgcacctgggagccctggggaccaccacgctc
ctccctgacacccgctgcctggtagacaactccaagagtcgtctgccccagctcctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaatggcgccgtc
atgaacaagggcacagggcgctgcctggaggtggagaaccgaggcctggctggcatcgac
ctcatcctccgcagctgcacgggacagaggtggacgattaagaacttcatcaagtag

DBGET integrated database retrieval system