KEGG   Delphinapterus leucas (beluga whale): 111182162
Entry
111182162         CDS       T05885                                 

Gene name
ABCB1
Definition
(RefSeq) ATP-dependent translocase ABCB1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle02010  ABC transporters
dle04976  Bile secretion
dle05206  MicroRNAs in cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    111182162 (ABCB1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    111182162 (ABCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111182162 (ABCB1)
  09162 Cancer: specific types
   05226 Gastric cancer
    111182162 (ABCB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dle02000]
    111182162 (ABCB1)
   04147 Exosome [BR:dle04147]
    111182162 (ABCB1)
   04090 CD molecules [BR:dle04090]
    111182162 (ABCB1)
Enzymes [BR:dle01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     111182162 (ABCB1)
Transporters [BR:dle02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    111182162 (ABCB1)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111182162 (ABCB1)
CD molecules [BR:dle04090]
 Proteins
  111182162 (ABCB1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_22 RsgA_GTPase Zeta_toxin Rad17 G-alpha AAA AAA_5 AAA_29 AAA_14 SbcCD_C DUF87 AAA_7 APS_kinase AAA_15 DUF815 AAA_30 PRK DUF2207 NTPase_1
Other DBs
NCBI-GeneID: 111182162
NCBI-ProteinID: XP_022444041
UniProt: A0A2Y9PFH2
LinkDB
Position
Unknown
AA seq 1286 aa
MDLEEGRSGRAGGENFLKRDKKRFFSKKDEKKEKKPTVSTFAVFRYSNWLDKLYMVLGTV
AAIIHGTGLPLMMLVFGDMTDSFANAGNLGNLTISELTNGSFLDSTYFGKKLEEEMTTYA
YYYSGIGAGVLVAAYIQVSFWCLAAGRQVYKIRKQFFHAIMRQEIGWFDVHDTGELNTRL
TDDVSKINEGIGDKIGIFFQSMATFFTGFTVGFTQGWKLTLVILAVSPVLGLSAAIWAKI
LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITA
NISMGAAFLLIYASYALAFWYGTSLVLSEEYSVGQVLTVFFSILIGAFSVGQASPSIEAF
ANARGAAYEIFKIIDNKPSIDSYSKNGRKPDNIKGNLEFRNVHFNYPSRNEVKILKGLNL
KVESGQTVALVGNSGCGKSTTVQLIQRLYDPTEGVISIDGQDIRTINVRYLREIIGVVSQ
EPVLFATTIAENIRYGRENVTMDEIEKAVKEASAYDFIMKLPNKFDTLVGERGAQLSGGQ
KQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKAREGRTTIVIAHRLSTVRNA
DVIAGLDDGVTVEKGSHDELMKEKGIYFRLVTMQTKGNEIELENAAGGSESEIDVLDMSP
KDLGSSLIRRKSTRKSIHGPQSQNRKLSREETLDENVPPVSFWRILKLNITEWPYFVVGI
FCAIINGGLQPAFSVIFSRIVGIFTRDDDPETKRQNSNLFSLLFLILGIISFITFFLQGY
TFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLAIDAAQVQGAIGSRLAV
ITQNIANLGTGIVISLIYGWQLTLLLLAIVPIIAVAGVFEMKMLSGQALKDKKELEDAGK
IATEAIENFRTVVSLTREEKFEYMYALSLQVPYRNSLRKAHIFGITFSITQAMMYFSYAG
CFRFGAYLVAHGIMDFQDVLLVFSAIVFGAMAVGQASSFAPDYAKAKVSAAHVIMAIEKT
PVIDSYSTEGLKPNTVEGNVTFNEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCG
KSTVVQLLERFYDPLAGTVLIDGKEIKHLNVQWLRAHMGIVSQEPVLFDCSIGENIAYGD
NSRVVSQEEIVQAAKEANIHPFVETLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPR
ILLLDEATSALDTESEKVVQEALDKAQEGRTCIVIAHRLSTIQNADLIVVIENGKVREHG
THQQLLAQRGIYFSMMDIPPFYKLLK
NT seq 3861 nt   +upstreamnt  +downstreamnt
atggatcttgaagaaggccgcagtggaagagcagggggggagaacttcttgaaaagggac
aagaaaaggtttttcagtaaaaaagatgagaagaaagaaaagaaaccaactgtcagtact
tttgcagtgtttcgctattcgaattggcttgataagttgtatatggtgttggggactgtg
gccgccatcatccacggaaccggactccccctcatgatgctggtttttggagacatgacg
gatagctttgcaaatgcaggaaatttaggaaacctaactatttcagaattaactaatgga
agttttctggacagtacatatttcggcaaaaagctggaggaggaaatgaccacgtacgcc
tattattacagtggaattggggctggcgtgcttgtcgccgcttacatccaggtttcattc
tggtgcctggcagcaggaagacaagtatacaaaattagaaaacagttttttcatgctatc
atgcggcaggagataggctggtttgacgtgcatgacactggggagcttaacacccggctc
acagatgacgtctccaaaattaatgaaggaattggtgacaaaattggaatattctttcag
tcaatggcaacattcttcaccggttttacagtaggatttacacaaggttggaagttaacc
cttgtgattttagccgtcagtcctgttcttggtctgtcagctgctatctgggcaaagata
ctatcttcatttactgataaagaactcttggcatatgcaaaagctggagcagtagctgaa
gaggtcttagcagcgattagaactgtgattgcatttggaggacaaaagaaagaacttgaa
aggtacaacaaaaatttggaagaagctaaaagaattggaataaagaaagctattacagcc
aacatttctatgggtgctgctttcctgttgatctatgcatcatatgctctggcattctgg
tatgggacctccttagtcctgtcagaagaatattctgttggacaagtactcactgtcttc
ttttccatattaattggggcttttagtgttggacaggcatctccaagcattgaggcattt
gcaaatgcaagaggagcagcttatgaaatctttaagatcattgataacaaaccaagcatc
gacagctattcgaagaacgggcgcaaacccgataatattaagggaaatctggaattcaga
aatgttcacttcaattacccatctcgaaacgaagttaagatcttgaagggcctcaacttg
aaggtagagagcgggcagacggtggcactggttggaaacagcggctgtgggaaaagcacg
acggttcagctgatacagaggctctatgaccccacggagggcgtgatcagtattgacggg
caggacatcaggaccatcaatgtaaggtatctgcgggaaattatcggtgtggtgagtcag
gaacctgtgttgtttgctaccaccatagccgagaacattcgctacggccgtgaaaatgta
accatggatgagattgagaaagctgtgaaggaagccagcgcctatgacttcatcatgaaa
ctgcctaataaatttgacaccctggttggagagagaggggcccagctgagtggtggacag
aagcagagaatcgccatcgctcgggctctggttcgcaaccccaagatcctgctgctggat
gaggccacctcagcgctggacactgagagtgaagcggtggttcaggtggccctggataag
gccagagaaggccggaccaccattgtgatcgcgcatcgtttgtccacagttcgtaatgct
gatgtcattgctggtcttgatgatggagtcactgtggagaaaggcagtcatgatgaactc
atgaaggagaaaggcatttacttcagacttgtcacaatgcagacaaaaggaaatgaaatt
gaattagaaaatgcagctggtggatccgaaagtgaaattgatgtcttggacatgtccccc
aaagatttaggatccagtctaataagaagaaaatcaactcgcaagagtatccatggacca
caaagccaaaacagaaagcttagtagagaagagactttggatgaaaatgtacctccagtt
tctttttggaggattctgaagctgaatataactgaatggccttattttgtggttggtata
ttttgtgccattataaatggaggtctgcaaccagcattttcagtaatattttcaaggatt
gtagggatttttaccagagatgacgatcctgaaaccaaacgacagaatagtaacttgttt
tcactcttgtttctaatccttggaattatttcttttattacgtttttccttcagggctac
acgtttggcaaggccggagagatcctcaccaagcgactccgatacatggttttcagatcc
atgctgagacaggatgtgagctggtttgacgaccctaaaaacaccacgggagccttgacg
accaggcttgccattgatgctgctcaagttcaaggggctataggttccaggcttgctgta
attacccagaatatagcaaatcttgggacaggcattgttatatccttaatctatggctgg
cagttaacacttttactgttagcaattgtacccatcattgcagtagcaggagtttttgaa
atgaaaatgctgtctggacaagcactgaaagataagaaagaactagaagatgccgggaag
attgccacggaagcaatagaaaacttccgaactgttgtgtctttgactcgggaggagaag
tttgaatatatgtatgccctgagtttgcaggtaccatacagaaactctctgaggaaagca
cacatctttggaatcacgttttccatcacccaggcaatgatgtacttttcttacgctggc
tgtttccgttttggcgcctacttggtggcacacggcatcatggactttcaggatgttctc
ttagttttctcagccattgtctttggcgcgatggctgtgggtcaggccagttcatttgct
cctgactatgccaaggccaaagtgtcagcagcccacgtcatcatggccattgaaaaaacc
cctgtgattgacagctacagcacggaaggcctaaagccgaatacagtggaaggaaatgtg
acatttaatgaagtcgtgttcaactatcccactcgaccagacatcccagtgcttcagggg
ctgagcctcgaggtgaagaagggccagacgctggccctggtgggcagcagcggctgtggg
aaaagcacggtggtccagctcctggagcggttctacgaccccttggctggaacagtgcta
attgacggcaaggaaataaagcacctgaatgtccagtggctccgagcacacatgggcatc
gtgtcccaggagcccgtcctgtttgactgcagcatcggcgagaacatcgcctacggggac
aacagccgggtcgtgtcacaggaggagatcgtgcaggcagccaaggaggccaacatacac
cccttcgtcgagacgctgcctgataaatataacaccagagtaggagacaaaggaactcag
ctctctggtggccagaagcagcgcattgcgatagctcgtgccctcgttagacagcctcgt
atattgcttctggatgaagctacatcagctctggatacagaaagtgaaaaggttgtccaa
gaagccctggacaaagcccaagaagggcgcacctgcatcgtcatcgctcaccgcctgtcc
accattcagaatgcagacttgatagtggtgattgagaacggcaaagtcagggagcacggc
acacatcagcagctgctggcacagagaggcatctacttctccatgatggacataccaccc
ttttacaaactccttaagtaa

DBGET integrated database retrieval system