KEGG   Delphinapterus leucas (beluga whale): 111182200
Entry
111182200         CDS       T05885                                 

Gene name
CD19
Definition
(RefSeq) B-lymphocyte antigen CD19 isoform X1
  KO
K06465  B-lymphocyte antigen CD19
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04640  Hematopoietic cell lineage
dle04662  B cell receptor signaling pathway
dle05169  Epstein-Barr virus infection
dle05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111182200 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111182200 (CD19)
   04662 B cell receptor signaling pathway
    111182200 (CD19)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    111182200 (CD19)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111182200 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dle04090]
    111182200 (CD19)
CD molecules [BR:dle04090]
 Proteins
  111182200 (CD19)
SSDB
Motif
Pfam: V-set Ig_3 ig Ig_2 I-set
Other DBs
NCBI-GeneID: 111182200
NCBI-ProteinID: XP_022444119
UniProt: A0A2Y9PAZ1
LinkDB
Position
Unknown
AA seq 570 aa
MPPPLLLFFLHLFLTPMGVRPQETHLLEAKEGGNAVLPCLEGLSDGPPEQLAWFRGSQST
PFLELNLGLPGLGIHVGPLGTLKEPQGTLLLIFNVSDQMGGFYLCQRGPFSEQGWQPGWT
VSVKGSGELFRWNASDLNDPSCGLGNRSSGGPRPSSGHPTRSQLYVWAKNGPETLHTDSA
CAPPNGTLNQSNNHDLTVAPGSTLSLSCGASRTSLARGPISWIRVHPKKPRTKLLSLNLS
EDAQLREMWVMGTLGGKAVLLLPETTAQDAGIYHCNHGNVTTQMQLKVTAQSAVWHWLLE
TGGWIVPVVTLVYLIFCLASLVGFLHLRRALILRRKRKRMTDPTRRFFKVTPPPGNGAQS
QYGNMLSLSTPHSGTGRALRWATGLGATVPPYGNPRSDAQEARASESRSPPGTGPEEEEG
EAYEEPDSEEGSEFYENDSNLGQDQLSQDGSGYENPEEGVLGPEDEDSFSNAAESYENED
EELAQPVARTTDFLSPHGSAWDPSREATSLGSQSYEDMRGILYAVPQLRFVQAQPGPSHE
EDADSYENMDNPDGPEPAWGGGGHMGTWSN
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgccacctcctctcctcctcttcttcctccacctgttccttacccccatgggagtcagg
ccccaggaaacacacctactggaggctaaagagggaggcaatgccgtgctgccatgcctt
gaaggtctctcagatggtccgcctgagcaactggcctggtttcggggctcccaatcaaca
cccttcttagagctgaacctagggttaccaggcctgggcatccatgtggggcccctgggc
accctgaaggagccccagggaaccttgctgctcatcttcaatgtctccgaccagatgggg
ggcttctacctgtgccagcgaggccccttttctgagcaaggctggcagcctggctggacg
gtcagcgtgaagggcagcggagaactgttccggtggaatgcttcagacctaaatgaccca
agctgtggcctggggaacaggtcctcagggggccccaggccctcttctggtcaccccaca
aggtcccagctctatgtgtgggccaagaacggccctgagaccttacacacagactctgcc
tgtgccccacctaacggcactttgaaccagagcaacaaccatgacctcacggtggcccct
ggctccacactctcgctgtcctgtggggcatcccgtacctcactggccagaggccccatc
tcctggatccgtgtgcatcccaagaagcctaggaccaaattgctgagcctaaacctgagt
gaggatgcccaactcagagagatgtgggtcatgggcaccctcgggggaaaggctgttctg
ttgctgcccgagaccacagctcaagatgctggcatctatcactgtaaccatggcaacgtg
accacccagatgcagctgaaggtcactgcccagtcagcagtatggcattggctactggag
actggtggctggatagtccctgttgtgactttagtttatctgatcttctgcctggcttcc
ctggtgggctttcttcatcttcgaagagccctgatcctgaggaggaaaagaaagcgaatg
acagatcccactagaaggttcttcaaagtgacgcctcccccgggaaacggggcccagagc
cagtacgggaacatgctctccctctccactccccactcaggcacgggacgcgccctgcgg
tgggctacgggcctgggagccaccgtgccgccctacggaaatccgcgcagcgacgcccag
gaggccagagcctcggagtcccggagcccaccagggaccggcccagaagaagaggaaggg
gaggcctatgaggagccggacagtgaggagggctccgagttctacgagaacgactccaac
cttgggcaggaccagctctcccaggatggcagcggctatgagaaccctgaggaaggggtc
ttgggtcctgaggatgaagactccttctccaacgcagctgaatcttacgagaatgaggat
gaagaactggcccagccagttgccaggacaacagacttcctgagcccccacgggtcagcc
tgggaccccagcagggaggcaacctcccttgggtcccagtcctatgaggatatgagaggg
atcctgtatgcagtcccccagctccgctttgttcaagcccagcctggtcccagtcatgaa
gaagatgcagactcttatgagaatatggataatcccgatggaccagaaccagcatgggga
ggagggggtcacatgggcacctggagcaactag

DBGET integrated database retrieval system