KEGG   Delphinapterus leucas (beluga whale): 111182348
Entry
111182348         CDS       T05885                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04664  Fc epsilon RI signaling pathway
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05221  Acute myeloid leukemia
dle05310  Asthma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182348
   04151 PI3K-Akt signaling pathway
    111182348
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182348
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111182348
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111182348
   04664 Fc epsilon RI signaling pathway
    111182348
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182348
   05202 Transcriptional misregulation in cancer
    111182348
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111182348
  09163 Immune disease
   05310 Asthma
    111182348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182348
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182348
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111182348
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Haparin
  Cytokines
   111182348
SSDB
Motif
Pfam: IL3 Hs1pro-1_C BRICHOS
Other DBs
NCBI-GeneID: 111182348
NCBI-ProteinID: XP_030618570
LinkDB
Position
Unknown
AA seq 149 aa
MRSLPILHRLLFLLALHTPQAQGAPVKTPGTQQCYVLSLIREIINELDKLHVASEDFLNS
NEKRRLMKTSLWRPNLEKFLTFATNSLGEDSKITKNLKEIQPILPTTMTTEEPILIEKDN
LGDFWVKLKEYLSAIRDSLNCKNTQRPNV
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcgcagcctgcccatcctgcatcggctcctgttcctgctcgcactccacacccctcag
gcacaaggggcaccggtcaagacaccaggaacccaacaatgctatgtactcagcctgatc
cgggaaattataaatgagctagacaagctacatgtggcttcagaagacttcttgaactca
aacgaaaagaggaggctgatgaaaacaagcctctggcggccaaacctggaaaaattcctg
acatttgccacaaattcccttggagaggattcgaaaatcacgaaaaatcttaaggaaatc
cagccaatcctgcccacaaccatgaccacggaagagccaatccttattgagaaggataac
ttgggtgatttctgggtgaaactgaaggaatatctgtctgccattagagactctctgaat
tgtaagaacacacagagacctaacgtctga

DBGET integrated database retrieval system