KEGG   Delphinapterus leucas (beluga whale): 111182418
Entry
111182418         CDS       T05885                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04672  Intestinal immune network for IgA production
dle05140  Leishmaniasis
dle05200  Pathways in cancer
dle05310  Asthma
dle05320  Autoimmune thyroid disease
dle05321  Inflammatory bowel disease
dle05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182418 (IL4)
   04151 PI3K-Akt signaling pathway
    111182418 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182418 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111182418 (IL4)
   04660 T cell receptor signaling pathway
    111182418 (IL4)
   04658 Th1 and Th2 cell differentiation
    111182418 (IL4)
   04659 Th17 cell differentiation
    111182418 (IL4)
   04657 IL-17 signaling pathway
    111182418 (IL4)
   04664 Fc epsilon RI signaling pathway
    111182418 (IL4)
   04672 Intestinal immune network for IgA production
    111182418 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182418 (IL4)
  09163 Immune disease
   05310 Asthma
    111182418 (IL4)
   05320 Autoimmune thyroid disease
    111182418 (IL4)
   05321 Inflammatory bowel disease
    111182418 (IL4)
   05330 Allograft rejection
    111182418 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111182418 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182418 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182418 (IL4)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111182418 (IL4)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Haparin
  Cytokines
   111182418 (IL4)
SSDB
Motif
Pfam: IL4 DUF4798
Other DBs
NCBI-GeneID: 111182418
NCBI-ProteinID: XP_022444473
UniProt: A0A2Y9PNT9
LinkDB
Position
Unknown
AA seq 133 aa
MGLTSQLIPMLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNLCMELPVEDVFATT
KNTTEKETFCRAGTVLRHIYRYHKCFNKPLSGLHRNLSSMANMTCSVNEAKKSTLKDFLE
TLKTIMKEKYSKC
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgatcccaatgctagtctgcttactggcatgtaccagcaac
ttcgtccatggacacaagtgcgatattaccttacaagagatcatcaaaacgctgaacatc
ctcacagcaagaaagaacttgtgcatggagctgcctgtagaagacgtctttgccaccaca
aagaacacaactgagaaggaaactttctgcagggccgggactgtgcttcggcatatctac
agataccacaagtgcttcaacaaacccctgagtggacttcacaggaacctcagcagcatg
gcaaacatgacctgttctgtgaatgaagccaagaagagtacgttgaaagacttcttggaa
acgctaaagacgattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system