KEGG   Delphinapterus leucas (beluga whale): 111182522
Entry
111182522         CDS       T05885                                 

Gene name
NRG2
Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform isoform X1
  KO
K05456  neuregulin 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04012  ErbB signaling pathway
dle05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111182522 (NRG2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111182522 (NRG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111182522 (NRG2)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111182522 (NRG2)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 EGF C2-set_2 V-set Ig_6 DUF3169 EGF_2 Laminin_EGF
Other DBs
NCBI-GeneID: 111182522
NCBI-ProteinID: XP_022444649
UniProt: A0A2Y9PCK2
LinkDB
Position
Unknown
AA seq 845 aa
MRQVCCSALPPPPLEKARCSSYSDSSSSERSSSSSGGESSSSRSSSSDSNSGISRPAAPP
EPRPSQQPQPRSPAAPRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQ
AYKAPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVG
SCAPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMK
SQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKV
EDAGEYVCEAENILGKDTVRGRLFVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIE
GINQLSCKCPVGYTGDRCQQFAMVNFSKHLGFELKEAEELYQKRVLTITGICVALLVVGI
VCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPAT
DHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLEHSESLTSDSQSGIMLSS
VGTSKCNSPACVEARARRAAAYSLEEQRRAAVPPYHDSIDSLRDSPHSERYVSALTTPAR
LSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLAEQQPLLRHPAPPGPGPGPG
TGADMQRSYDSYYYPTAGPGPRRGACALGGSLGSLPASPFRIPEDDEYETTQECAPPPPP
RPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASASDDEADDAD
GALAAESTPFLGLRAAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPPPRAKQ
DSGPL
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgcggcaggtttgctgctcagcgctgccgccgccgccactggagaaggctcggtgcagc
agctacagcgacagcagcagcagcgagaggagcagcagcagcagcggcggcgagagcagc
agcagcaggagcagcagcagcgacagcaacagcggcatctctcgtcccgctgcgccccca
gagccgcggccgtcgcaacagccgcagccccgcagccccgcagccccgagagccgccgcc
cgctcgcgagccgcagccgccggcggcatgaggcgcgacccggcccccggcttctctatg
ctgctcttcggtgtgtcactcgcctgctactcgcctagcctcaagtcggtgcaggaccag
gcgtacaaggcacccgtggtggtggagggcaaggtacaagggctggccccggccggcggc
tccagctccaacagcacccgtgagccgcccgcctcgggtcgggtggcactggtgaaggtg
ctggacaagtggccgctccggagcgggggactgcagcgcgagcaggtgatcagcgtgggc
tcctgtgcgccgctcgaaaggaaccagcgctacatctttttcctggagcccacggagcag
cccttggtctttaagacagcctttgcccctcttgacactaacggcaaaaacctcaagaaa
gaggtgggcaagatcctgtgcactgactgcgccacccggcccaagctgaagaagatgaag
agccagacaggacaggtgggtgagaagcaatcactgaagtgtgaggcagcagctggtaac
ccccagccctcctaccgctggttcaaggacggcaaggagctcaaccgcagccgcgacatt
cgcatcaagtacggcaatggcagaaagaactcacgactacagttcaacaaggtgaaggtg
gaggacgctggggagtacgtctgcgaggctgagaacatcctggggaaggacaccgtcagg
ggccggctcttcgtcaacagcgtgagcactaccctatcatcctggtcggggcacgcccgc
aagtgcaacgagacagccaagtcctattgtgtcaacggaggcgtctgctactacatcgag
ggcatcaaccagctctcctgcaagtgtcctgtgggatacaccggggacaggtgtcagcag
ttcgcaatggtcaacttctccaagcaccttggatttgaactaaaggaagccgaggagctg
taccagaaaagggtcctgactatcaccggcatttgcgtggctctgctggtcgtgggcatc
gtctgcgtggtcgcctactgcaagaccaaaaaacagcggaagcagatgcataaccacctt
cgacagaacatgtgtccagcccaccagaaccggagcttggccaatgggcccagccacccc
cggctggaccctgaggagatccagatggcagactatatctccaagaatgtgccagccaca
gaccatgtcatccggagggaaacggagaccaccttctctgggagccactcctgttctcct
tctcaccactgctccacagccacgcccacctccagccacaggcatgagagccacacgtgg
agcctggaacattctgagagcctgacctccgactcccaatcgggcatcatgctgtcatca
gtgggcaccagcaagtgcaacagcccagcgtgtgtggaggcgcgggcacggcgggcggca
gcctacagcctagaggagcagcgcagggctgctgtgccaccttaccacgactccatagac
tccctgcgtgactccccacacagcgagaggtatgtgtcggccctgaccacgcccgcgcgc
ctctctcccgtggacttccattactcgctggccacgcaggtgccgactttcgagatcacg
tcccccaactcggcgcacgccgtgtcgctgccgccggccgcgcccatcagctaccgcctg
gcggagcagcagccgctcctgcggcacccggcgccccccggccccggtccagggcccggg
accggtgcggacatgcagcgcagctacgacagctactactaccccacggcgggaccgggg
ccgcggcgcggggcctgcgccctaggcggcagcctgggcagtctgcccgccagccctttc
cgcatccccgaggacgacgagtacgagaccacgcaggagtgcgcgcccccgccgccgccg
cggccgcgcgcccgcggcgcgtcccgtaggacgtctgctggaccccggcgctggcgccgc
tcgcgcctcaacgggctggcggcgcagcgcgcacgcgcggcgcgggactcgctgtcgctg
agcagcggctcgggaggcggctcggcttccgcctcggacgacgaagctgacgacgcggac
ggggcgctggcggccgagagcacgcctttcctcggcctgcgtgcggcgcacgacgcgctg
cgctcggactcgccgccgctctgcccggcggccgacagcaggacttactactccctggac
agccacagcacgcgggccagcagcagacacagccgcgggccgcccccgcgggccaagcag
gactcggggcccctctag

DBGET integrated database retrieval system