KEGG   Delphinapterus leucas (beluga whale): 111182724
Entry
111182724         CDS       T05885                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory-associated protein of mTOR isoform X1
  KO
K07204  regulatory associated protein of mTOR
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04136  Autophagy - other
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04714  Thermogenesis
dle04910  Insulin signaling pathway
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111182724 (RPTOR)
   04152 AMPK signaling pathway
    111182724 (RPTOR)
   04150 mTOR signaling pathway
    111182724 (RPTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111182724 (RPTOR)
   04136 Autophagy - other
    111182724 (RPTOR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111182724 (RPTOR)
  09149 Aging
   04211 Longevity regulating pathway
    111182724 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    111182724 (RPTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    111182724 (RPTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111182724 (RPTOR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111182724 (RPTOR)
Membrane trafficking [BR:dle04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    111182724 (RPTOR)
SSDB
Motif
Pfam: HEAT HEAT_2 WD40 Cnd1 HEAT_EZ Raptor_N Hyccin WD40_2
Other DBs
NCBI-GeneID: 111182724
NCBI-ProteinID: XP_022445094
UniProt: A0A2Y9PDV2
LinkDB
Position
Unknown
AA seq 1151 aa
MGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAA
CEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDR
RTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPV
SSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVE
NRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSAR
ELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNS
YNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLC
SLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVRKELVV
ALSHLVVQYESNFCTVALQFMEEEKNYPLPSPATTEGGSLTPVRDSPCTPRLRSVSSYGN
IRAVTTARSLNKSLQNLSLTEESSGSVAFSPGNLSTSSSASSTLGSPENEEYILSFETID
KMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYKATVNA
RPQRILTTSSLTQSAPASPTNKGIHIHQAGGSPPTSSASSSSLTNDVAKQPVSRDLPAGR
PGTTGPVAVQYTPHSHQFPRTRKMFDKGPDQTTDDPDDAAGHKSFISATMQTGFCDWSAR
YFAQPVMKVIPEEHDLESQIRKEREWRFLRNTRVRKQAQQLIQKGITRLDDQIFLNRNPG
VPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLL
LTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDV
RIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRV
MTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIIKGLTALDIHPQ
ANLIACGSMNQFTAIYNGSGDLINHIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYY
ISVYSVEKRVR
NT seq 3456 nt   +upstreamnt  +downstreamnt
atgggcagcccctccatattcgtctacgactgctccaacgctggtctcattgtcaagtcc
ttcaaacagttcgccctgcagagggagcaggagctggaggtcgctgctattaacccaaac
caccccctggcccagatgcctttgcccccatccatgaagaactgcattcagctggcagcc
tgtgaggccaacgagctcctgcccatgatccccgaccttccagccgacctattcacgtca
tgcctcaccacccccatcaaaatcgccctgcgctggttttgcatgcagaaatgcgttagt
ctggtgcctggagtcacactggatttgatagaaaagattcccgggcggctgaacgacagg
aggacccccctgggcgagctgaactggatcttcacggccatcacggacaccattgcatgg
aacgtgcttcctcgggatctcttccaaaagctcttcagacaggacctattggtggctagt
ctgtttcgaaattttttattggcggaaaggatcatgaggtcgtataactgcacccccgtc
agcagtccacgcctgccccccacgtacatgcacgccatgtggcaggcctgggacctggct
gtcgacatttgtctctcccagctgccaaccatcatcgaagaaggcacggcatttcggcac
agccccttctttgctgagcagctgaccgccttccaggtgtggctcacgatgggcgtggag
aacaggaacccacctgagcagcttcccattgtcttacaggtgctgctgagccaagtgcac
cggctgagagccctggacctgctgggaagatttctggacctgggtccctgggcggtgagc
ctggccttgtctgtgggtattttcccctacgtgctgaagctgctccagagctcagccagg
gagctgcggcctctccttgtcttcatctgggccaagatcctcgccgtggacagttcgtgc
caagctgacctggtgaaggacaacggccacaagtacttcctctcggtcttggcagatccg
tacatgccagctgagcacaggaccatgacagccttcattctggctgtgatcgttaacagc
tataacacggggcaggaagcctgcctccagggaaacctgatcgccatctgcctggagcag
ctcaacgatccccaccccctgctgcgccagtgggtggccatctgcctcggccggatctgg
cagaactttgactcggcccggtggtgcggggtgagggacagcgctcacgagaagctctgc
agccttctctccgaccccatccctgaggtgcgctgcgcagcagtctttgccctcggcaca
tttgtgggcaactccgcagagaggacggaccactccaccaccatcgaccacaatgtggcc
atgatgctggcccagctcatcaacgacggcagccccgtggtccggaaggaactggtggtg
gctctgagtcaccttgtcgttcaatacgaaagcaatttctgcaccgtggccctgcagttc
atggaagaggagaagaactacccactgccctctccagccaccacagagggtgggagtctg
acccccgtgcgggacagcccctgcacccccagactgcgctccgtgagctcctacggaaac
atccgcgccgtcaccacggctagaagcttgaacaaatctttgcaaaatctgagtctgaca
gaagaatccagcggctcggtggccttctcccccgggaacctgagcaccagcagcagcgcc
agcagcaccctgggcagccccgagaacgaggagtacatcctgtcctttgagaccatcgac
aagatgcgccgagtcagctcctactcctccctcaactccctcatcggtgtttcattcaat
agtgtttacactcaaatttggagagtcttgctacatctggctgcggatccctatccagat
gtttccgatttggctatgaaagtactcaacagcattgcctacaaggccacagtgaacgcc
cggcctcagcgcatcctcaccacctcttccctcactcagtcggcacccgccagccccacc
aacaagggcatccacatccaccaggcgggaggctccccaccaacatccagtgcaagcagc
tccagcctgaccaacgacgtggccaagcagccggtcagccgagacctgcctgcaggccgg
ccgggcaccacaggccccgtggcggtacagtacacaccccactcccaccagttcccccgg
acacggaagatgttcgacaagggcccagaccagaccactgacgacccggatgatgctgcc
gggcacaaaagtttcatttcggccacaatgcagacagggttctgcgactggagcgcgcgg
tacttcgcccagcctgtcatgaaggtaatcccggaagagcatgacctggagagtcagatc
cgcaaggagcgggagtggcggtttctgcgaaacacccgcgtcaggaagcaggcgcagcag
ctcatccagaagggtatcacaaggctggacgaccagatatttctgaacaggaaccctggt
gtcccctccgtggtcaagtttcacccctttacaccgtgtgtggccgtcgctgacaaagac
agcatctgtttttgggactgggagaaaggggagaagctggattatttccacaacggaaac
cctcggtacacgagggtcacggccatggagtatctgaatggccaggactgctcactcctg
ctcacagccacagatgacggtgccatcagagtctggaagaactttgctgatttggaaaag
aatccagaaatggtgacggcctggcaggggctctccgacatgctgcccaccacccgagga
gctgggatggtggtggactgggaacaggagaccgggctcctcatgagctcgggagatgtg
cgtatcgtccggatctgggacacggatcgtgagatgaaggtgcaggacatccccacaggt
gccgacagctgcgtgacgagcctgtcctgcgactcccaccgctccctcatcgtggctggg
ctcggcgacggctccatccgcgtctacgacaggaggatggcgctcagcgaatgccgcgtc
atgacataccgggagcacacggcctgggtggtgaaggcctacctccagaagcaccctgag
ggccacatcatgagcgtcagcgtcaacggggacgtgcgcttcttcgaccctcggatgccg
gagtccgtgaacgtcctgcagatcattaaggggctgacggcccttgacatccacccccag
gcaaacctgatcgcgtgtggctccatgaaccagttcaccgccatctacaatggcagcgga
gatctgatcaaccacatcaagtactacgacggcttcatgggccagcgagtcggcgccatc
agctgcctggctttccacccacactggcctcacctcgccgtgggcagcaacgactactac
atctccgtgtactcggtggagaagcgcgtcagatag

DBGET integrated database retrieval system