KEGG   Delphinapterus leucas (beluga whale): 111182757
Entry
111182757         CDS       T05885                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04120  Ubiquitin mediated proteolysis
dle04380  Osteoclast differentiation
dle04630  JAK-STAT signaling pathway
dle04668  TNF signaling pathway
dle04910  Insulin signaling pathway
dle04917  Prolactin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04935  Growth hormone synthesis, secretion and action
dle05160  Hepatitis C
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111182757 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182757 (SOCS3)
   04668 TNF signaling pathway
    111182757 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111182757 (SOCS3)
   04920 Adipocytokine signaling pathway
    111182757 (SOCS3)
   04917 Prolactin signaling pathway
    111182757 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    111182757 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111182757 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111182757 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    111182757 (SOCS3)
   04931 Insulin resistance
    111182757 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111182757 (SOCS3)
   05164 Influenza A
    111182757 (SOCS3)
   05168 Herpes simplex virus 1 infection
    111182757 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111182757 (SOCS3)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111182757 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box Exostosin
Other DBs
NCBI-GeneID: 111182757
NCBI-ProteinID: XP_022445166
UniProt: A0A2Y9PIR4
LinkDB
Position
Unknown
AA seq 237 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPSGAPSSSSPPAEPSSSPPAEPSSSPSSEVPEQPSAQPLPGSPPRRAYYIY
SGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 714 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgccgtgacgggcggcgaggcgaacctactgctc
agcgccgagcccgccggcaccttcctcatacgcgacagctcggatcagcgccacttcttc
acgctcagcgtcaagacgcagtcggggaccaagaacctgcgcatccagtgcgaggggggc
agcttctcgctgcagagcgatcctcggagcacgcagccagtgccccgcttcgactgcgtg
ctcaagctggtgcatcactacatgccgccctccggcgccccctcctcctcctcgccccca
gctgaaccctcctcctcgccccccgctgaaccctcctcctcgccctcctccgaggtgccc
gagcagccgtcggcccagccgctcccggggagcccccccaggagagcctattacatctac
tcggggggcgagaagatccctctggtgttgagccggcccctctcctccaacgtggccact
ctccaacatctgtgtcggaagaccgttaacggccacctggactcctatgagaaagtcacc
cagctgcctgggcccattcgggagttcctggaccagtacgatgcccccctttag

DBGET integrated database retrieval system