KEGG   Delphinapterus leucas (beluga whale): 111182912
Entry
111182912         CDS       T05885                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111182912 (AXIN2)
   04390 Hippo signaling pathway
    111182912 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111182912 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182912 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111182912 (AXIN2)
   05225 Hepatocellular carcinoma
    111182912 (AXIN2)
   05226 Gastric cancer
    111182912 (AXIN2)
   05217 Basal cell carcinoma
    111182912 (AXIN2)
   05213 Endometrial cancer
    111182912 (AXIN2)
   05224 Breast cancer
    111182912 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111182912 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    111182912 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111182912 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111182912 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111182912 (AXIN2)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111182912 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind DUF4148
Other DBs
NCBI-GeneID: 111182912
NCBI-ProteinID: XP_022445529
UniProt: A0A2Y9PJS0
LinkDB
Position
Unknown
AA seq 843 aa
MSSAVLVPRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGPVAKPLPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDAKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSVMFDQAQTEIQA
VMEDNAYQMFLTSDIYLEYVRSGGENPACVGGGGLGSLKLVCGYLPTLNEEEEWTCADFK
CKLSPSVVGLSSKTLRATVGVRSTETVENGHRRSDPVNPYHVGSGCIFAPATSANDSEIS
SDALTDDSMSMTDSSVDGIPPYLGGSKKQLQREMHRSVKANGQVCLPHFPRTHRLPKEMT
PVEPAAFAAELISRLEKLKLELETRHSLEERLQQIREDEEKEGSELALSAREAGPTQHPL
SLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRARSPDQHRRHHLLQHRAPPP
PGGPLLPATAAAAGCPLLGARGFVSRQTTKHVHHHYIHHHAGPRTREEVEAEAAQRARCP
CPVPTPGGSDYPCCAKCKSHPGAPEPAAAAQAGGRGRGAVPPRRSGRGSEPGPAGPAREG
GAPGGAGPLQPPGEEGDRAQDVWQWVLESERPGKPKPHSAQSTKRAYPLECARASPAGRH
HLWVGSSGHPRATPRAHPFTQDPAVPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRHHSATGQPGATPFSSPSLASEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASNEFACGAVFEEVWDDEVVLPTYEGRILGKVE
RID
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgagcagcgctgtgttggtgcctcgcctcccagaccccagcagcagcttccgcgaggat
gccccgcggcccccagtgccgggcgaagaaggggagaccccaccgtgccagcccggggtg
ggaaagggcccggtcgccaaacccctgcctgtctcctccaatgccagaaggaatgaggac
gggttgggggagccggaggggcgggcgtctccggattcccctctgaccaggtggaccaag
tccctgcactccttgctgggtgaccaagacggtgcttatctcttccggactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggatgccaaaactttacgagtagccaaagcgatctacaagaggtacatcgag
aacaacagcattgtctccaagcagctgaaacctgccaccaagacctacatcagagatggc
atcaagaagcagcagatcgattctgtcatgtttgaccaggcgcagactgagatccaggcg
gtgatggaggacaatgcttaccagatgtttctgacttctgatatatacctcgaatacgtg
aggagtgggggtgaaaacccagcctgcgtgggcggcggggggctggggagcctgaagctc
gtgtgtggctacctccccacgctgaatgaggaggaagagtggacttgcgccgacttcaag
tgcaaactgtcccccagcgtggtcggcttgtccagcaaaaccctgagggctacagtcggt
gtgaggtccacagaaactgtggagaatggacacaggaggagcgacccggtgaatccgtac
cacgtgggttctggctgcatcttcgcgccagccaccagcgccaacgacagcgagatatcc
agtgatgcgctgaccgacgattccatgtccatgacggacagtagcgtagatggaatccct
ccttacctcggggggagtaagaaacagctccagagagaaatgcatcgcagcgtgaaggcc
aacggccaggtgtgcctacctcatttcccgagaacccaccgcctgcccaaggagatgacc
cccgtggagcccgctgccttcgcggccgaactcatctcccggctggagaagctgaagctg
gagctggagacgcggcacagcctggaggagcgcctgcagcagatccgagaggacgaggag
aaggagggctccgagctggcgctgagcgcccgggaggcggggcccacccagcaccccctc
tccctcttgccatcgggcagctacgaggaggacccgcagaccatcctggacgaccacctg
tccagggtcctcaagacccccggctgccagtccccgggcgtgggccgctacagcccccgc
gcacgctccccggaccagcatcgccgccaccacctcctgcagcaccgcgcgcccccgccc
cccgggggcccgctgctccccgccaccgccgccgcagccggctgccccctcctcggggcc
cggggcttcgtgagcaggcagacaacgaagcacgtccaccaccactacatccaccaccat
gccggcccccggacccgggaggaggtggaggccgaggccgcccagcgcgcgcgctgcccc
tgccccgtccccacccccgggggctccgactacccctgctgcgccaagtgcaagagccac
cccggggcgccggagcccgcggcggccgcgcaggctggcggccgcggccgaggcgccgtc
ccaccccgacggagcgggagaggctcggagccaggcccggctgggccagcccgggaagga
ggggcccccggcggagcggggccgctgcagccgcccggggaggagggagaccgggcacag
gacgtatggcagtgggtgctggagagcgagcgtccgggcaagcccaagccgcacagtgcc
caaagcaccaagcgggcctatcccttggagtgcgcccgagcgtccccagccggccgtcac
cacctgtgggtgggcagcagcgggcacccccgcgccaccccccgtgcccacccgttcacc
caggaccctgcggtgcctcccctgaccccacccaacaccctggcgcagctggaggaggcc
tgccgccggctggcggaggtgtccaagcccccaaagcagcggtgctgcgtggccagtcag
cagagggacaggcaccactcggccactggtcagccaggagccacgcccttctccagccca
agcctggcttcggaagatcacaaagagccaaagaagctggcaggggtgcacgctctccag
gccagcgagctggtggtcacctacttcttctgcggggaggaaatcccgtaccggaggatg
ctgaaggctcagagcctgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcgagcaacgagttcgcgtgtggagccgtgtttgaggag
gtctgggacgacgaggtggtgctgcccacgtacgagggccggatcctggggaaggtggag
aggatcgactga

KEGG   Delphinapterus leucas (beluga whale): 111185093
Entry
111185093         CDS       T05885                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04934  Cushing syndrome
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111185093 (AXIN1)
   04390 Hippo signaling pathway
    111185093 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111185093 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111185093 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111185093 (AXIN1)
   05225 Hepatocellular carcinoma
    111185093 (AXIN1)
   05226 Gastric cancer
    111185093 (AXIN1)
   05217 Basal cell carcinoma
    111185093 (AXIN1)
   05213 Endometrial cancer
    111185093 (AXIN1)
   05224 Breast cancer
    111185093 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111185093 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    111185093 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111185093 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111185093 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111185093 (AXIN1)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111185093 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Sec16
Other DBs
NCBI-GeneID: 111185093
NCBI-ProteinID: XP_022450020
UniProt: A0A2Y9PXY0
LinkDB
Position
Unknown
AA seq 866 aa
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPISHSFCSGKGAGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKDCIMKQQIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGVPGYLPT
LNEDEEWKCDQDVDEDDGRDPAPPGRLTQKLLLETAAPRASSSRRYSEGREFRYGSWREP
VNPYYVNSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGVPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEVRVEPQKFAAELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDVSSGPPGASHKLPSAPAWHHFPPRYADVSCVGLRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSAHMPKMGALGGTVPGHGKHVPKSGAKLDTAGLHLHRHGHHHGHH
GSARPKEPAEAEASRRVQSSFAWGPELHGHAAKPRSHVESMGAAPTTSDSLAYSGKASMT
SKRNSKKAESGKSTSVEAPGPSEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGAKKQQA
HESSRPLSIERPGAVHPWVSAQLRTSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEE
EEKRASKAPSRQRYVQEVIQRGRSCVRPACTPVLSVVPAVSDLELSETETKSQRKAGGGS
AQSCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGNYRYYFKKVSDEFECGVV
FEEVREDGAVLPVFEEKVIGKVEKVD
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccccttggacctcggagcaagtttcaccgaagatgcc
ccccgacccccagtgcctggtgaggagggtgaactggtgtccacggaccccaggcccatc
agccacagcttctgctctgggaaaggtgccggaattaaaggtgagacttcaacagccact
ccgaggcgctcagatctggacctggggtacgagcctgagggcagcgcttcgcccacccct
ccgtacttgaagtgggccgagtcgctgcactccctactggatgatcaagacgggataaac
ctgtttagaacttttctgaagcaggaggactgtgctgatctcctggacttctggtttgcc
tgcagcggcttcaggaaactggagccctgtgactcgaatgaggagaagaggctgaagctg
gccagagctatctaccgcaagtacatccttgataacaatggcattgtgtccaggcagacc
aagccagccaccaagagcttcataaaggactgcatcatgaagcagcagattgatcctgcc
atgttcgaccaggcccagacggaaatccagtctaccatggaggagaacacctacccctcg
ttcctcaagtccgatatttatttggagtacacgaggacaggctcggagagcccaaagctc
tgcagtgaccagagctccgggtcggggacagggaagggagtacctggatacctacccact
ttgaacgaagatgaggaatggaaatgtgaccaagacgtagacgaagacgatggcagagac
cctgctccccccggcaggctcacgcagaagctgctcctggaaaccgccgccccgagggcc
tcctcaagtagacggtacagcgaaggcagagagttcaggtatggatcctggcgggagcct
gtcaacccctactacgtcaactctggctatgccctcgccccagccaccagcgccaacgac
agtgagcagcagagcctgtccagcgatgctgacagcctgtccctcaccgacagcagcgtg
gatggagtcccaccttacaggatccgcaagcagcaccgccgggagatgcaggagagcgtc
caggtcaacgggcgcgtgcctctacctcacattcctcgcacgtaccgaatgccaaaggaa
gtccgtgtggagccccagaagtttgccgcagagctcatccaccgcctggaggctgtgcag
cggacgcgggaggccgaggagaagctggaggagcggctgaagcgtgtccggatggaggaa
gaaggtgaggatggtgatgtgtcctctggccccccaggggccagtcataagctgccttca
gccccggcctggcaccacttcccaccccgctacgcggatgtgagctgtgtggggctgcgg
gatgcacatgaggagaacccggagagcatcctggacgagcatgtgcagcgagtcatgagg
acaccgggctgccagtcaccagggcccggccaccgctccccggacagtgcgcacatgccc
aagatgggagcgctaggaggcacagttcccgggcatggaaagcacgtgcccaagtcgggg
gcgaagctggacacagctggcctgcacctccacagacacggccaccaccacggccaccat
ggctcagctaggcccaaggagcctgccgaggccgaggcctcccgccgggtccagagcagc
ttcgcgtggggcccagagctgcacggccacgcggccaagccccgaagccacgtggagagc
atgggtgccgcccccaccaccagtgacagcctggcctacagcgggaaggcaagcatgacc
tccaaaagaaactccaagaaggctgagtcggggaagagcaccagcgtggaggcgccaggc
ccctctgaggacgcagagaagaaccagaaaatcatgcagtggatcatcgagggcgagaag
gagatcagcaggcaccggaaggctggccatgggtcgtccggggcaaaaaagcagcaggcc
cacgagagctcccggcccttgtccatcgagcgccccggggccgtgcacccctgggtcagc
gcccagctccggacctccgtgcagccctcgcatctcttcatccaggaccccacgatgccg
cccaacccggcccccaaccctctgacgcagctggaggaggcccgccggcgcctggaggag
gaggagaagagggccagcaaggcgccctcgaggcagaggtatgtgcaggaggtcatccag
cgggggcgctcctgtgtcaggccagcgtgcacgcccgtgctgagcgtggtgccagcggtg
tccgacctggagctctccgagacagagacaaaatcgcagaggaaggcaggcggtgggagt
gcccagtcgtgtgacagcatcgtcgtggcctactatttctgtggggagcccatcccctac
cggaccctggtgaggggccgtgcggtcaccctgggccagttcaaggagctgctgaccaag
aaaggcaactacagatactacttcaagaaggtgagcgacgagttcgaatgcggcgtggtg
ttcgaggaggtgcgtgaggacggggccgtgctgcccgtcttcgaggagaaggtcatcggc
aaggtggagaaggtggactga

DBGET integrated database retrieval system