KEGG   Delphinapterus leucas (beluga whale): 111182917
Entry
111182917         CDS       T05885                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04066  HIF-1 signaling pathway
dle04070  Phosphatidylinositol signaling system
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04270  Vascular smooth muscle contraction
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04510  Focal adhesion
dle04540  Gap junction
dle04650  Natural killer cell mediated cytotoxicity
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04670  Leukocyte transendothelial migration
dle04713  Circadian entrainment
dle04720  Long-term potentiation
dle04723  Retrograde endocannabinoid signaling
dle04724  Glutamatergic synapse
dle04725  Cholinergic synapse
dle04726  Serotonergic synapse
dle04727  GABAergic synapse
dle04728  Dopaminergic synapse
dle04730  Long-term depression
dle04750  Inflammatory mediator regulation of TRP channels
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04929  GnRH secretion
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle04960  Aldosterone-regulated sodium reabsorption
dle04961  Endocrine and other factor-regulated calcium reabsorption
dle04970  Salivary secretion
dle04971  Gastric acid secretion
dle04972  Pancreatic secretion
dle05017  Spinocerebellar ataxia
dle05022  Pathways of neurodegeneration - multiple diseases
dle05031  Amphetamine addiction
dle05032  Morphine addiction
dle05143  African trypanosomiasis
dle05146  Amoebiasis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05223  Non-small cell lung cancer
dle05225  Hepatocellular carcinoma
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111182917 (PRKCA)
   04012 ErbB signaling pathway
    111182917 (PRKCA)
   04014 Ras signaling pathway
    111182917 (PRKCA)
   04015 Rap1 signaling pathway
    111182917 (PRKCA)
   04310 Wnt signaling pathway
    111182917 (PRKCA)
   04370 VEGF signaling pathway
    111182917 (PRKCA)
   04066 HIF-1 signaling pathway
    111182917 (PRKCA)
   04020 Calcium signaling pathway
    111182917 (PRKCA)
   04070 Phosphatidylinositol signaling system
    111182917 (PRKCA)
   04072 Phospholipase D signaling pathway
    111182917 (PRKCA)
   04071 Sphingolipid signaling pathway
    111182917 (PRKCA)
   04151 PI3K-Akt signaling pathway
    111182917 (PRKCA)
   04150 mTOR signaling pathway
    111182917 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111182917 (PRKCA)
   04540 Gap junction
    111182917 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111182917 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    111182917 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    111182917 (PRKCA)
   04670 Leukocyte transendothelial migration
    111182917 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    111182917 (PRKCA)
   04929 GnRH secretion
    111182917 (PRKCA)
   04912 GnRH signaling pathway
    111182917 (PRKCA)
   04921 Oxytocin signaling pathway
    111182917 (PRKCA)
   04926 Relaxin signaling pathway
    111182917 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    111182917 (PRKCA)
   04918 Thyroid hormone synthesis
    111182917 (PRKCA)
   04919 Thyroid hormone signaling pathway
    111182917 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    111182917 (PRKCA)
   04916 Melanogenesis
    111182917 (PRKCA)
   04925 Aldosterone synthesis and secretion
    111182917 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111182917 (PRKCA)
   04270 Vascular smooth muscle contraction
    111182917 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    111182917 (PRKCA)
   04971 Gastric acid secretion
    111182917 (PRKCA)
   04972 Pancreatic secretion
    111182917 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111182917 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    111182917 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    111182917 (PRKCA)
   04727 GABAergic synapse
    111182917 (PRKCA)
   04725 Cholinergic synapse
    111182917 (PRKCA)
   04728 Dopaminergic synapse
    111182917 (PRKCA)
   04726 Serotonergic synapse
    111182917 (PRKCA)
   04720 Long-term potentiation
    111182917 (PRKCA)
   04730 Long-term depression
    111182917 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    111182917 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111182917 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    111182917 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111182917 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182917 (PRKCA)
   05206 MicroRNAs in cancer
    111182917 (PRKCA)
   05205 Proteoglycans in cancer
    111182917 (PRKCA)
   05231 Choline metabolism in cancer
    111182917 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111182917 (PRKCA)
   05214 Glioma
    111182917 (PRKCA)
   05223 Non-small cell lung cancer
    111182917 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    111182917 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    111182917 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    111182917 (PRKCA)
   05032 Morphine addiction
    111182917 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111182917 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111182917 (PRKCA)
   05161 Hepatitis B
    111182917 (PRKCA)
   05171 Coronavirus disease - COVID-19
    111182917 (PRKCA)
   05164 Influenza A
    111182917 (PRKCA)
   05163 Human cytomegalovirus infection
    111182917 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111182917 (PRKCA)
   05143 African trypanosomiasis
    111182917 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111182917 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111182917 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111182917 (PRKCA)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     111182917 (PRKCA)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   111182917 (PRKCA)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    111182917 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 111182917
NCBI-ProteinID: XP_022445555
UniProt: A0A2Y9PID1
LinkDB
Position
Unknown
AA seq 670 aa
MADVFPANDSAAPQDVANRFARKGALRQKNVHEVKDHRFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTEEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNAE
LRQKFEKAKLGPAGNKVISPDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTE
ELYAIKILKKDVVIQDDDVECTLVEKRVLALPDKPPFLTQLHSCFQTVDRLYFVMEYVNG
GDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADF
GMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGED
EDELFQSIMEHNVSYPKSLSREAVSICKGLMTKHPGKRLGCGPEGERDVREHTFFRRIDW
EKLENREVQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQ
FVHPILQSTV
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggctgacgtcttcccggccaacgactcggcggcgcctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctaagacagaagaacgtgcacgaggtgaaggaccaccgcttcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgactttatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcagataaaggacctgacactgatgaccccaggagc
aagcacaaattcaagatccacacctacggaagccccaccttctgcgatcactgcgggtcg
ctgctgtacggactcatccatcaggggatgaagtgtgacacctgtgatatgaacgtgcac
aagcagtgcgtgataaacgtccccagcctctgcgggatggaccacacggagaagaggggc
cggatctacctgaaggccgaggtcaccgaggaaaagctccacgtcacagtacgagatgca
aaaaatctcatccctatggatccaaatgggctttcagatccttatgtgaagctgaagctt
attcctgaccccaagaacgaaagcaaacaaaaaaccaaaaccatccgttccacactgaac
ccccagtggaatgagtcctttacgttcaaattaaaaccttcagataaagatcgacgactg
tccgtagagatctgggactgggatcgaacaaccaggaacgacttcatggggtccctttcc
ttcggagtctcggagctgatgaagatgccggccagtggatggtacaagttgctgaaccaa
gaagagggtgagtactacaacgtgcccattccagaaggcgatgaggaaggcaacgcagag
ctgaggcagaagttcgagaaagccaagctcggccctgctggcaacaaagtcattagtcct
gacaggagacagccttccaacaacctcgacagagtgaaactcaccgacttcaacttcctc
atggtgctgggcaagggcagcttcgggaaggtgatgctggcggacaggaaggggacggag
gagctgtacgccatcaagatattgaagaaggacgtggtgatccaggacgacgatgtggag
tgcaccctggtggagaagcgggtgctggccctgccggacaagccgccgttcctgacgcag
ctgcactcctgcttccagacggtggatcggctgtacttcgtcatggaatacgtcaatggc
ggggacctcatgtaccacatccagcaagtaggaaaatttaaggaaccgcaagcagtgttc
tacgcagcagagatttccattgggttgttctttcttcataaaagaggcatcatttataga
gacctgaagttagataacgtcatgctggattcggaaggacatatcaagattgcggacttt
gggatgtgtaaggagcacatgatggacggggtgactaccaggaccttctgcgggaccccg
gattacatcgccccggagataatcgcttatcagccatatgggaaatccgtggactggtgg
gcctacggcgtcctgttatatgaaatgctggccgggcagcctccatttgacggcgaggat
gaagacgagctgtttcagtccatcatggagcacaacgtctcgtacccgaagtccttgtcc
agggaggccgtctccatctgcaaagggctgatgaccaaacaccctggcaagcggctgggc
tgcggacccgagggagagcgggacgtgcgggaacacaccttcttccggaggatcgactgg
gagaagctggagaacagggaggtccagccgcccttcaagcccaaagtgtgcggcaaagga
gcagaaaacttcgacaagttcttcacgcgagggcagcctgtcttaacgccacccgatcag
ctggtcatcgctaacatcgaccagtctgattttgaagggttctcatatgtcaacccccag
ttcgtgcaccccatcctacagagcacagtatga

DBGET integrated database retrieval system