KEGG   Delphinapterus leucas (beluga whale): 111183037
Entry
111183037         CDS       T05885                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111183037 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111183037 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dle03310]
    111183037 (NR3C1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    111183037 (NR3C1)
Nuclear receptors [BR:dle03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   111183037 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 111183037
NCBI-ProteinID: XP_022445694
UniProt: A0A2Y9PK97
LinkDB
Position
Unknown
AA seq 777 aa
MDPKESLSPPSREEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQADSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQMSLSSGETDF
RLLEESIANLNRSTSVPENPKNAASAPPEKEFPKTHSDVSSEQQNLKGQTGTNGGNVKLY
TTDQSTFDIWRKKLQDLEFSSGSPSKETSESPWSSDLLIDENCLLSPLAGEDDPFLLEGN
AKEDCKPLVLPDTKPKIKDNGDLILSSPNSVPLPQVKTEKEDFIELCTPGVIKQEKLGPV
YCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENSANKTIVPATLPQLTPTLVSLLEVIE
PEVVYAGYDSSIPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMSFALGWRSYRQSSSNLLCFAPDLIINEQRMALPCMYDQCKHMLYVSSELNRLQVSY
EEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggaccccaaggaatcattaagcccccccagtagagaagaaatccccagcagtgtgctt
ggtcgagagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttctgcatcttcaccctcactggctgctgcttctcaggccgactccaagcagcaa
agacttttggttgattttccaaaaggctccggaagcaatgcgcagcagccagatctgtcc
aaggcagtttcactctcaatgggactgtatatgggagagacagagacaaaagtaatggga
aatgacctgggattcccacagcagggccaaatgagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttccagagaacccc
aagaatgcagcatcagcccccccagagaaggagtttccaaaaactcactctgatgtatct
tcagagcagcaaaatttgaagggccagactggcactaatgggggtaacgtgaagttgtat
accacagaccaaagcacctttgacatatggaggaaaaaactccaggatttggagttttct
tctgggtccccaagtaaagagacaagtgagagtccttggagctcagacctcttgatagat
gaaaactgtttgctttctcctttggcaggagaggatgatccattccttctggaaggaaac
gcaaaagaggactgtaagcctcttgttttaccggacactaaacctaaaattaaggataat
ggagatctgatcttatcaagccccaacagtgtgccactgccccaagtgaaaacagaaaaa
gaagattttattgaactctgcacccctggagtaattaagcaggagaaactgggcccagtt
tattgtcaggccagcttttctggagcaaatataattggtaataaaatgtctgccatttct
gttcatggtgtgagtacctctgggggacagatgtaccactatgacatgaatacagcatcc
ctttctcaacagcaggatcagaaacctatttttaatgtcattccaccaattcctgttggt
tcagaaaattggaatagatgccaaggatctggagatgataacttgacttccttagggact
ttgaacttctccggtcgatcggttttttctaatggctattcaagccctggaatgagacca
gatgtaagctctcctccatccagctcctcagcagcaacgggaccacctcccaaactctgc
ctagtgtgctctgatgaagcttcgggatgtcattatggggtcttaacttgtggaagctgt
aaagtattcttcaaaagagcagtggaaggtagacagcacaattatctttgtgctggaaga
aatgattgcatcattgataaaattcgaagaaaaaactgcccagcatgccgctatagaaaa
tgtcttcaagcaggaatgaacctggaagctcgtaaaacaaagaaaaagataaaaggaatt
cagcaggccactacaggagtctcacaagaaacttctgaaaattctgctaacaaaacaata
gtccctgcaacgttaccgcaactcacccctaccctggtgtcactgctggaggtcattgag
ccggaggtggtatatgcgggctacgacagctccattccagatacaacttggcggatcatg
actacactcaacatgttaggtgggcggcaggtgatcgcagcggtgaaatgggcgaaggcg
ataccaggattcaggaacttacatctggatgaccaaatgaccctactgcaatattcatgg
atgttcctcatgtcattcgccctggggtggagatcatacagacaatcaagttcaaacttg
ctgtgttttgctcctgatctgattattaatgagcagagaatggctttaccctgcatgtat
gaccaatgtaaacatatgctatatgtttcctctgagttaaacagacttcaggtatcttat
gaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaaggaaggtttg
aagagtcaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagcc
attgtcaagagggaaggaaactccagtcagaactggcagcggttttaccaactgacaaaa
ctcttggactccatgcatgacgtggttgaaaatctccttaactattgcttccaaacattt
ttggataagaccatgagtattgaattcccagagatgttagctgaaatcatcaccaatcag
ataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system