KEGG   Delphinapterus leucas (beluga whale): 111183091
Entry
111183091         CDS       T05885                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04020  Calcium signaling pathway
dle04024  cAMP signaling pathway
dle04066  HIF-1 signaling pathway
dle04114  Oocyte meiosis
dle04217  Necroptosis
dle04261  Adrenergic signaling in cardiomyocytes
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04713  Circadian entrainment
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04740  Olfactory transduction
dle04750  Inflammatory mediator regulation of TRP channels
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04916  Melanogenesis
dle04921  Oxytocin signaling pathway
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04934  Cushing syndrome
dle04971  Gastric acid secretion
dle05012  Parkinson disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05031  Amphetamine addiction
dle05152  Tuberculosis
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05214  Glioma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111183091 (CAMK2A)
   04310 Wnt signaling pathway
    111183091 (CAMK2A)
   04066 HIF-1 signaling pathway
    111183091 (CAMK2A)
   04020 Calcium signaling pathway
    111183091 (CAMK2A)
   04024 cAMP signaling pathway
    111183091 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111183091 (CAMK2A)
   04217 Necroptosis
    111183091 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111183091 (CAMK2A)
   04922 Glucagon signaling pathway
    111183091 (CAMK2A)
   04912 GnRH signaling pathway
    111183091 (CAMK2A)
   04921 Oxytocin signaling pathway
    111183091 (CAMK2A)
   04916 Melanogenesis
    111183091 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    111183091 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111183091 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    111183091 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    111183091 (CAMK2A)
   04728 Dopaminergic synapse
    111183091 (CAMK2A)
   04720 Long-term potentiation
    111183091 (CAMK2A)
   04722 Neurotrophin signaling pathway
    111183091 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    111183091 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    111183091 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    111183091 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111183091 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183091 (CAMK2A)
   05205 Proteoglycans in cancer
    111183091 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    111183091 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111183091 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    111183091 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    111183091 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111183091 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111183091 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111183091 (CAMK2A)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111183091 (CAMK2A)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   111183091 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH SnoaL_4 Kdo SnoaL_2
Other DBs
NCBI-GeneID: 111183091
NCBI-ProteinID: XP_022445827
UniProt: A0A2Y9PR48
LinkDB
Position
Unknown
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDEAACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIIHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaactggga
aagggagccttctcagtggtgcgcaggtgtgtgaaggtgctggctggccaggaatatgct
gccaagatcatcaacactaagaagctctcggccagagaccaccagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacattgtccggctccacgacagcatctcc
gaggagggacaccattacctgatctttgacctcgtcaccggcggggagctgtttgaagac
atcgtggcccgggagtactacagtgaggccgatgccagtcactgtatccagcagatcctg
gaggccgtgctgcactgccaccagatgggggtggtacaccgggacttgaagccggagaac
ctgttgctcgcctccaagctcaagggcgccgcagtgaagctggcggactttggcctggcc
atagaggtggagggggaacagcaggcatggtttgggttcgcaggaacacccggatacctc
tccccagaagtgctgcggaaggacccatacgggaagcctgtggatctgtgggcctgtggg
gtcatcctgtacatcctgctggttgggtatcccccgttctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagctggcgcctatgatttcccgtcaccagaatgggacaccgtc
accccggaagccaaggatctgatcaataagatgctgaccatcaacccatccaaacgcatc
acggccgccgaggccctcaagcacccctggatctcgcaccggtccaccgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggagaaaactgaag
ggagccatcctcaccactatgctggccaccaggaacttctccggcgggaagagtggagga
aacaagaagaacgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcagagagcaccaacaccaccattgaggatgaagacaccaaagtgcggaaacaagaa
attataaaagtgacagaacagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgtgaccccgggatgacagccttcgaacccgaggccctagggaacctggtc
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagcct
gtgcacaccaccatcctgaatccccacattcacctgatgggtgacgaggcggcctgcatc
gcctacatccgcatcacgcagtacctggatgcgggcggcatcccccgcacggcccagtca
gaagagacccgcgtctggcaccgccgggatggcaaatggcagatcatccacttccacaga
tctggggcgccctccgtcctgccccactga

KEGG   Delphinapterus leucas (beluga whale): 111183530
Entry
111183530         CDS       T05885                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04020  Calcium signaling pathway
dle04024  cAMP signaling pathway
dle04066  HIF-1 signaling pathway
dle04114  Oocyte meiosis
dle04217  Necroptosis
dle04261  Adrenergic signaling in cardiomyocytes
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04713  Circadian entrainment
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04740  Olfactory transduction
dle04750  Inflammatory mediator regulation of TRP channels
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04916  Melanogenesis
dle04921  Oxytocin signaling pathway
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04934  Cushing syndrome
dle04971  Gastric acid secretion
dle05012  Parkinson disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05031  Amphetamine addiction
dle05152  Tuberculosis
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05214  Glioma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111183530 (CAMK2G)
   04310 Wnt signaling pathway
    111183530 (CAMK2G)
   04066 HIF-1 signaling pathway
    111183530 (CAMK2G)
   04020 Calcium signaling pathway
    111183530 (CAMK2G)
   04024 cAMP signaling pathway
    111183530 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111183530 (CAMK2G)
   04217 Necroptosis
    111183530 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111183530 (CAMK2G)
   04922 Glucagon signaling pathway
    111183530 (CAMK2G)
   04912 GnRH signaling pathway
    111183530 (CAMK2G)
   04921 Oxytocin signaling pathway
    111183530 (CAMK2G)
   04916 Melanogenesis
    111183530 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    111183530 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111183530 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    111183530 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    111183530 (CAMK2G)
   04728 Dopaminergic synapse
    111183530 (CAMK2G)
   04720 Long-term potentiation
    111183530 (CAMK2G)
   04722 Neurotrophin signaling pathway
    111183530 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    111183530 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    111183530 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    111183530 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111183530 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183530 (CAMK2G)
   05205 Proteoglycans in cancer
    111183530 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    111183530 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111183530 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    111183530 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    111183530 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111183530 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111183530 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111183530 (CAMK2G)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111183530 (CAMK2G)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   111183530 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 Pkinase_fungal SnoaL_2 Kdo
Other DBs
NCBI-GeneID: 111183530
NCBI-ProteinID: XP_022446609
UniProt: A0A2Y9PI43
LinkDB
Position
Unknown
AA seq 610 aa
MFNHLGMPSQDWTYHCGPGQFSGLTPFGAGDASLQDRPCIWKRCSANLTCSSNTTAAGVE
PFAFSQTWSSPGGDNRTGSEGGKGQETTAGEVGCWLAVRGVRSQGERDHQKLEREARICR
LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNH
IHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVL
RKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK
NLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILT
TMLVSRNFSAAKSLLNKKSDGGVKPQSNNKNSLVSPAQEPAPLQTAMEPQTTVVHNATDG
IKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQ
EIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSK
PIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYH
CSGAPAAPLQ
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgtttaatcaccttgggatgccaagccaggactggacctaccactgtggaccaggccag
ttcagtggccttaccccttttggggctggggatgcgagtttacaggacagaccttgcatc
tggaaaagatgctctgcaaaccttacttgttcctcaaacaccactgctgctggggtggag
ccctttgctttttcccagacatggagcagccctggaggggacaacaggaccggaagtgag
gggggaaagggacaagagacaacagctggagaggtggggtgctggctggctgtgcgagga
gtaaggagtcagggagagcgtgatcaccagaaactagaacgtgaggcccggatatgccga
cttttgaagcatccaaacattgtacgcctccatgacagtatttctgaagaagggtttcac
tacctcgtgtttgaccttgttaccggtggggagctgtttgaagacattgtggccagagaa
tactacagtgaagctgatgccagccactgtatacatcagattctggagagtgttaaccat
atccaccagcatgacattgtccaccgggacctgaagcctgagaacctcctgctggcgagt
aaatgcaagggtgccgcagtcaagctggctgattttggcctagccatcgaagtacaggga
gagcaacaggcttggtttggttttgctggcaccccaggttacttgtcccctgaggtcttg
aggaaagatccctatggaaaacctgtggatatctgggcctgcggggtcatcctgtatatc
ctcctggtgggctaccctcccttctgggatgaggatcagcacaagctgtaccagcagatc
aaggctggagcctatgatttcccatcaccagagtgggacacggtgactcctgaagccaag
aacttgatcaaccagatgctgaccataaaccctgcaaagcgtatcacagctgaccaggct
ctcaagcatccatgggtctgtcaacggtccacagtggcatctatgatgcatcgtcaagag
accgtggagtgcctacgcaagttcaatgcccggagaaaactgaagggtgccatcctcacg
accatgcttgtctccaggaacttttcagctgccaaaagcctattgaacaagaagtcggac
ggcggtgtcaagccacagagcaacaacaaaaacagtctcgtaagcccagcccaagagccc
gcgcccttgcagacggccatggagccacaaaccactgtggtccacaacgctacagatggg
atcaagggctccacagagagctgcaacaccaccacagaagatgaggacctcaaagctgcc
ccgctccgcactgggaatggcagctcggtgcctgaaggacggagctcccgggacagaaca
gccccctctgcaggcatgcagccccagccttctctctgctcctcagccatgcgaaaacag
gagatcattaagatcacagaacaactaattgaggccatcaacaatggggactttgaggcc
tacacgaagatttgtgatccaggcctcacttcctttgagcctgaggccctcggtaacctc
gtggaagggatggatttccataagttttactttgagaatctcctgtccaagaacagcaag
cccatccacaccaccatcctgaacccgcacgtccacgtgattggagaggacgcggcttgc
atcgcctacatccgccttacccagtacatcgatgggcagggccggcctcgcaccagccag
tcagaggagacccgggtctggcaccgccgggatggcaagtggctcaatgtccactatcac
tgttcaggggcccctgccgcaccgctgcagtga

KEGG   Delphinapterus leucas (beluga whale): 111184516
Entry
111184516         CDS       T05885                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04020  Calcium signaling pathway
dle04024  cAMP signaling pathway
dle04066  HIF-1 signaling pathway
dle04114  Oocyte meiosis
dle04217  Necroptosis
dle04261  Adrenergic signaling in cardiomyocytes
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04713  Circadian entrainment
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04740  Olfactory transduction
dle04750  Inflammatory mediator regulation of TRP channels
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04916  Melanogenesis
dle04921  Oxytocin signaling pathway
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04934  Cushing syndrome
dle04971  Gastric acid secretion
dle05012  Parkinson disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05031  Amphetamine addiction
dle05152  Tuberculosis
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05214  Glioma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111184516 (CAMK2B)
   04310 Wnt signaling pathway
    111184516 (CAMK2B)
   04066 HIF-1 signaling pathway
    111184516 (CAMK2B)
   04020 Calcium signaling pathway
    111184516 (CAMK2B)
   04024 cAMP signaling pathway
    111184516 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111184516 (CAMK2B)
   04217 Necroptosis
    111184516 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111184516 (CAMK2B)
   04922 Glucagon signaling pathway
    111184516 (CAMK2B)
   04912 GnRH signaling pathway
    111184516 (CAMK2B)
   04921 Oxytocin signaling pathway
    111184516 (CAMK2B)
   04916 Melanogenesis
    111184516 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    111184516 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111184516 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    111184516 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    111184516 (CAMK2B)
   04728 Dopaminergic synapse
    111184516 (CAMK2B)
   04720 Long-term potentiation
    111184516 (CAMK2B)
   04722 Neurotrophin signaling pathway
    111184516 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    111184516 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    111184516 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    111184516 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111184516 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184516 (CAMK2B)
   05205 Proteoglycans in cancer
    111184516 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    111184516 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111184516 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    111184516 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    111184516 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111184516 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111184516 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111184516 (CAMK2B)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111184516 (CAMK2B)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   111184516 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 APH Kdo Pkinase_fungal SnoaL_4
Other DBs
NCBI-GeneID: 111184516
NCBI-ProteinID: XP_022448793
UniProt: A0A2Y9Q072
LinkDB
Position
Unknown
AA seq 542 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSTHTTIEDEDTKARKQEIIKITEQ
LIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILN
PHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAP
LQ
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacttgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagcaaagatcatcaacaccaagaagctatctgccagagatcaccagaagctggagaga
gaggctcgaatctgccgtcttctgaagcattccaacatcgtgcgtctccacgacagcatc
tccgaggaaggcttccactacctggtcttcgatctggtcaccggcggggagctctttgag
gacatcgtggcgagagagtactacagcgaggcagacgccagtcactgcatccagcagatc
ctggaggcggttctccattgccaccaaatgggggttgtccacagggacctcaagcccgag
aacctgcttctggccagcaagtgcaaaggggccgcagtgaagctggcggacttcggcctg
gctatcgaggtgcagggggaccagcaggcctggtttgggttcgctggcacgccaggctac
ctgtccccagaggtgctgcgcaaggaggcgtacggcaagccggtggacatctgggcgtgc
ggggtgatcctgtacatcttgctggtgggctacccacccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggccggggcctatgacttcccatccccggagtgggacacg
gtcactcctgaagccaaaaacctcatcaaccagatgttaaccatcaaccctgccaagcgc
atcacggcgcacgaggcgctgaagcacccgtgggtctgccaacgctccactgtggcctcc
atgatgcacaggcaggagaccgtggagtgcctgaaaaagttcaatgcccggcggaagctc
aagggcgcgatcctcaccaccatgctggccacgcggaatttctcagtgggcagacagacc
accgctccagccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagacggagtcaagccccagacaaatagcaccaaa
aacagtgcggctgccaccagccccaaggggacgcttcctccagctgccctggaacctcaa
accaccgtcattcataacccagtggacgggatcaaggagtcatctgacagcacccacacc
accatagaggacgaagacacaaaagcgcggaagcaggagatcatcaagatcacggagcag
ctcatcgaggccgtcaacaacggtgactttgaggcctatgcgaaaatctgcgacccaggc
ctgacctcgtttgagcccgaagccctgggcaacctggttgaaggaatggacttccacaga
ttctacttcgagaacttgctcgccaagaacagcaagccgatccacacgacgatcctgaac
ccgcacgtgcacgtcatcggcgaggacgccgcgtgcatcgcctacatccgcctcacgcag
tacatcgacgggcagggccggccccgcaccagccagtccgaggagacccgcgtgtggcac
cgccgagacggcaagtggcagaacgtgcacttccactgctcgggggcgcccgtggccccg
ctgcagtga

KEGG   Delphinapterus leucas (beluga whale): 111186068
Entry
111186068         CDS       T05885                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04020  Calcium signaling pathway
dle04024  cAMP signaling pathway
dle04066  HIF-1 signaling pathway
dle04114  Oocyte meiosis
dle04217  Necroptosis
dle04261  Adrenergic signaling in cardiomyocytes
dle04310  Wnt signaling pathway
dle04360  Axon guidance
dle04713  Circadian entrainment
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04740  Olfactory transduction
dle04750  Inflammatory mediator regulation of TRP channels
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04916  Melanogenesis
dle04921  Oxytocin signaling pathway
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04934  Cushing syndrome
dle04971  Gastric acid secretion
dle05012  Parkinson disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05031  Amphetamine addiction
dle05152  Tuberculosis
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05214  Glioma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111186068 (CAMK2D)
   04310 Wnt signaling pathway
    111186068 (CAMK2D)
   04066 HIF-1 signaling pathway
    111186068 (CAMK2D)
   04020 Calcium signaling pathway
    111186068 (CAMK2D)
   04024 cAMP signaling pathway
    111186068 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111186068 (CAMK2D)
   04217 Necroptosis
    111186068 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111186068 (CAMK2D)
   04922 Glucagon signaling pathway
    111186068 (CAMK2D)
   04912 GnRH signaling pathway
    111186068 (CAMK2D)
   04921 Oxytocin signaling pathway
    111186068 (CAMK2D)
   04916 Melanogenesis
    111186068 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    111186068 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111186068 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    111186068 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    111186068 (CAMK2D)
   04728 Dopaminergic synapse
    111186068 (CAMK2D)
   04720 Long-term potentiation
    111186068 (CAMK2D)
   04722 Neurotrophin signaling pathway
    111186068 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    111186068 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    111186068 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    111186068 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111186068 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186068 (CAMK2D)
   05205 Proteoglycans in cancer
    111186068 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    111186068 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111186068 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    111186068 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    111186068 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111186068 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111186068 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111186068 (CAMK2D)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111186068 (CAMK2D)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   111186068 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal SnoaL_2 Kdo SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 111186068
NCBI-ProteinID: XP_022451974
UniProt: A0A2Y9PYV0
LinkDB
Position
Unknown
AA seq 542 aa
MRRPSVNQQEDLHQEPNRAGTLTPDFQPPERGAFSVVRRCMKIPTGQEYAAKIINTKKLS
ARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEA
DASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAW
FGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAY
DFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCL
KKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQ
TTVIHNPDGNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGL
TAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQY
MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSRTVPIKPSCIPNGKENFSGSTSLWQ
NI
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgagaaggccatctgtaaaccagcaagaggaccttcatcaagaacccaaccgtgctggt
accctgaccccagacttccaacctccagaaaggggggcattctcagtggtgagaagatgt
atgaaaatccctactggacaagaatatgctgccaaaattatcaacaccaaaaagctttct
gctagggatcatcagaaactggaaagggaagctagaatctgccgtcttttgaagcacccc
aatattgtgcgacttcacgacagcatatcggaagagggcttccattacttggtgtttgat
ttagttactggaggtgaactgtttgaagacatagtggcgagagaatattacagtgaagcc
gacgccagtcattgtatacagcagattctagaaagtgtaaatcattgtcacctaaatggc
atagttcacagggacctgaagcctgagaatttgcttttagctagcaaatccaagggagca
gctgtgaaactggcagactttggcttagccatagaagttcaaggagaccagcaggcgtgg
tttggttttgctggcacacctggatatctttctccagaagttttacgcaaagatccttat
ggaaagccagtggatatgtgggcgtgtggggtcattctctacattctactggttggatat
ccacccttctgggatgaagaccagcacagactctatcagcagatcaaggctggagcttat
gattttccatcaccggagtgggacacagtgactcctgaagccaaagacctcatcaataaa
atgcttactatcaaccctgccaagcgtatcacagcctcggaggcactgaaacacccatgg
atctgtcaacgttctactgttgcttccatgatgcacagacaggagactgttgactgcttg
aagaaattcaatgccagaagaaaactgaagggtgccatcttgacaactatgctggctacg
aggaatttttcagcagccaagagtttgttgaagaaaccagatggagtaaagataaacaac
aaagccaacgtggtaaccagccccaaagaaaatattcctaccccggcgctggagccccaa
actactgtaatccacaaccctgatggaaacaaggagtcaactgagagttcaaatacaaca
attgaggatgaagatgtgaaagcacgaaagcaagagattatcaaagttactgaacaactc
atcgaagctatcaacaacggggactttgaagcttacacgaaaatctgtgacccaggcctt
actgcttttgaacctgaagctttgggtaatttagtggaagggatggactttcatcgattc
tactttgagaatgctttgtccaaaagcaataaaccaatccacactattatcctgaacccc
cacgtacatctggtaggcgatgatgctgcctgcatagcatacattaggctcacacagtac
atggatggcagcggaatgccaaaaacaatgcagtcagaagagacacgtgtgtggcaccgc
cgggatggaaagtggcagaatgttcattttcatcgctcggggtcgcgaacagtacccatc
aagccatcttgtattccaaatgggaaagaaaacttctcaggaagcacctctttgtggcaa
aacatctaa

DBGET integrated database retrieval system