KEGG   Delphinapterus leucas (beluga whale): 111183456Help
Entry
111183456         CDS       T05885                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00010  Glycolysis / Gluconeogenesis
dle00051  Fructose and mannose metabolism
dle00052  Galactose metabolism
dle00500  Starch and sucrose metabolism
dle00520  Amino sugar and nucleotide sugar metabolism
dle00524  Neomycin, kanamycin and gentamicin biosynthesis
dle01100  Metabolic pathways
dle01200  Carbon metabolism
dle04066  HIF-1 signaling pathway
dle04910  Insulin signaling pathway
dle04930  Type II diabetes mellitus
dle04973  Carbohydrate digestion and absorption
dle05230  Central carbon metabolism in cancer
Module
dle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dle_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111183456 (HK1)
   00051 Fructose and mannose metabolism
    111183456 (HK1)
   00052 Galactose metabolism
    111183456 (HK1)
   00500 Starch and sucrose metabolism
    111183456 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    111183456 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111183456 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111183456 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111183456 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111183456 (HK1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    111183456 (HK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111183456 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111183456 (HK1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111183456 (HK1)
Membrane trafficking [BR:dle04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111183456 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 111183456
NCBI-ProteinID: XP_022446460
UniProt: A0A2Y9PL00
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMARFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQKQTVHMESEVYDTPESIMH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKRFKASGV
EGTDVVKLLEKAIKKHGDYDANVVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAREILTRLG
VEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKSTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFSLT
KDTLLEVKRRMRAEMELGLGKQTHDKAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPTEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGQDVATLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVETLEGNEGQMCINMEWGAFGDNGCLDD
IRTIYDKLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEPLKTRG
IFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRQETSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcttattacttcaccgaactgaaggatgaccaagtcaaa
aagatcgacaaatatctctatgccatgcggctctctgatgaaactctgttagatatcatg
gctcgtttcaaaaaggagatgaagaatggcctctcccgggattttaatccgacagccaca
gtcaagatgttgccaacgtttgtaaggtccattcctgacggttcagaaaagggagatttc
attgccctggatcttggcgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
caaaaacagactgttcatatggagtccgaggtttacgacaccccggagagcatcatgcac
ggcagtggaagccagctttttgatcatgtcgctgagtgcctgggagacttcatggagaaa
aaaaaaatcaaagacaagaaattacctgtcggattcacgttttctttcccttgtcggcaa
tccaaaatagacgaggccatcctgatcacctggacaaagagatttaaagcaagtggagtg
gagggaacggatgtggtgaagctgcttgagaaagccatcaaaaagcacggggactatgac
gccaacgttgtggctgtggtgaacgacactgtggggaccatgatgacctgtggctacgac
gaccagcagtgtgaagtcggcctcatcattggcacgggcaccaacgcgtgctacatggag
gaactgaggcacatcgacctggtggaaggcgacgaagggaggatgtgcatcaacaccgag
tggggggccttcggggacgacggggccctggaggacatccgcaccgagtttgaccgggag
attgaccggggctcactcaaccccgggaagcagctgtttgagaagatggtcagtggcatg
tacatgggcgagctggtccgattgatcctggtcaagatggccaaggagggccttttattt
gaagggcggatcaccccggagctgctcaccagagggaagtttaacaccagtgacgtgtca
gccattgaaaagaataaggaaggcctccacaatgccagagaaatcctgacccgcctggga
gtggagccatctgatgacgactgtatttcagtccagcacgtgtgcaccattgtctcgttc
cgctctgccaacctagtggctgcgacgctgggcgccatcctgaatcgtcttcgagataac
aagagcacacccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagtattcccggcgtttccacaagaccctgaggcgcttggtgcccgactgcgatgtg
cgtttcctcctctcggagagtggcagcggcaagggggctgccatggtgaccgcagtggcc
taccgcctggctgagcagcaccggcagatagaggagaccctggcccacttcagtctcacc
aaggatacgctgctggaggtgaaaaggaggatgcgggccgagatggaattggggctgggc
aagcagacgcatgacaaggccgtcgtcaagatgctgccctcctttgtccggagcactcct
gatgggacagagcacggtgacttcctggccctggatcttggaggaacaaatttccgcgtc
ttgctggtgaaaattcgtagtgggaaaaagagaacagtggaaatgcacaacaagatctac
gccattcccacggaaatcatgcagggcactggggaagagctgtttgaccacatcgtttcc
tgcatctctgacttcctggactacatgggcatcaagggccccagaatgcctctgggcttc
acgttttcgtttccctgcaagcagacgagcttggacgcgggaatcttgatcacctggacg
aaaggttttaaggcaactgattgcgtggggcaggatgtagcgaccttactgagggatgcg
gtaaaaaggagagaggaatttgacctggacgtggtggctgtggtcaatgacacggtgggc
accatgatgacctgtgcttatgaggagcccacctgcgaggttggactcatcgtagggacg
ggcagcaatgcctgctacatggaagaaatgaaaaacgtcgagacgctagaaggaaacgag
ggccaaatgtgtatcaacatggagtggggtgcctttggggacaacgggtgtctggatgat
atcagaacgatctatgacaaactggtggatgaatattctctaaacgctgggaagcaaagg
tatgagaagatgatcagcggtatgtacctgggtgaaatcgtccgcaacatcttaattgac
ttcaccaagaggggattccttttccgagggcagatctctgagccgctgaagactcggggc
atctttcagaccaagtatctctctcagatcgagagcgaccgattagcgctgctgcaggtc
cgggccatcctccagcaacttggcctgaacagcacgtgtgacgacagcatcctcgtgaag
accgtgtgcggggtagtgtccaagagggccgcacagctgtgtggcgcaggtatggctgcc
gtggtggacaagatccgcgagaacagggggctggaccacctcaacgtgactgtgggcgtg
gatgggacgctctacaagcttcatccgcatttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccaaagtgtaacgtgtccttcctcttatccgaagacggtagcggcaaggga
gccgccctcatcacggcagtgggcgttcggctccggcaagaaacgagcagctaa

DBGET integrated database retrieval system