KEGG   Delphinapterus leucas (beluga whale): 111183491
Entry
111183491         CDS       T05885                                 

Gene name
DDIT4
Definition
(RefSeq) DNA damage-inducible transcript 4 protein
  KO
K08270  DNA-damage-inducible transcript 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111183491 (DDIT4)
   04150 mTOR signaling pathway
    111183491 (DDIT4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111183491 (DDIT4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111183491 (DDIT4)
SSDB
Motif
Pfam: RTP801_C
Other DBs
NCBI-GeneID: 111183491
NCBI-ProteinID: XP_022446541
UniProt: A0A2Y9PMR2
LinkDB
Position
Unknown
AA seq 229 aa
MPSLWDRFSSSSSSSSLSRTPTPDQPPRSAWGSAAREEALGRCASLESSDCESLDSSNSG
FGPEEDSSYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQL
VSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDS
RLWPKIQGLFSSANSPFVPGFSQSLTLSTGFRVIKKKLYSSEQLLIEEC
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcctagcctttgggatcgcttctcgtcgtcctcttcgtcctcgtccttgtcccgaact
cccaccccagatcagccgccacgctcagcctgggggtcggcggcccgagaagaggcactc
ggccgctgcgcgagcctggagagctcggactgcgagtccctggacagcagcaacagtggc
tttgggccggaggaagactcttcttacctggatggggtgtccctgcccgacttcgagctg
ctcagcgatcccgaggatgagcacctgtgtgccaacctgatgcagctgctgcaggagagc
ctggcccaggcacggctgggctcgcggcgccctgcacgcctgctgatgcccagccagctg
gtgagccaggtgggcaaagaactactgcgcctggcctacagcgagccgtgcggcctgcgg
ggggcgctgctagacgtctgcgtagagcagggcaagagctgccacagcgtgggtcaactg
gctctcgaccccagccttgtgcccaccttccagctgaccctcgtgctgcgcctggactca
cgcctctggcccaagatccaggggttgtttagctccgccaactctcccttcgtccccggc
ttcagccagtccctgacgctgagcacaggcttccgagtaatcaaaaagaagctgtacagc
tcagagcagctgctcattgaggagtgttga

DBGET integrated database retrieval system