KEGG   Delphinapterus leucas (beluga whale): 111183533
Entry
111183533         CDS       T05885                                 

Gene name
PLAU
Definition
(RefSeq) urokinase-type plasminogen activator
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04610  Complement and coagulation cascades
dle05202  Transcriptional misregulation in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111183533 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    111183533 (PLAU)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111183533 (PLAU)
   05206 MicroRNAs in cancer
    111183533 (PLAU)
   05205 Proteoglycans in cancer
    111183533 (PLAU)
  09162 Cancer: specific types
   05215 Prostate cancer
    111183533 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111183533 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111183533 (PLAU)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     111183533 (PLAU)
Peptidases and inhibitors [BR:dle01002]
 Serine peptidases
  Family S1: chymotrypsin family
   111183533 (PLAU)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   111183533 (PLAU)
SSDB
Motif
Pfam: Trypsin Kringle Trypsin_2 DUF316 DUF1986
Other DBs
NCBI-GeneID: 111183533
NCBI-ProteinID: XP_022446632
UniProt: A0A2Y9PI69
LinkDB
Position
Unknown
AA seq 431 aa
MRLLLACLLLCALVVRDSEGSHELHQVSGASKCGCLNGGKCVSYKYFSNIQRCNCPKKFQ
GEHCEIDTSKTCYQGNGHSYRGKANTDTSGRPCLAWNSPTILLKTYHAHRPDALQLGLGK
HNYCRNPDNQRRPWCYVHVGLMQIVQECMVHSCSSGKSALSPPEKLQCGQKALRPRFKIV
GGEFTTIENQPWFAAIYRRHRAGSVTYVCGGSLISPCWVVSATHCFIEYQKKEDYIVYLG
RSKLNSITPGEMQFEVQKLILHEDYSADTLAHHNDIALLKIRSSTGQCAQPSRSIQVICL
PPANGDARFGTSCEVTGFGKENPSDYIYPEQLKMTAVKLVSHEECQQPHYYGTEVTSKML
CAADPQWETDSCQGDSGGPLVCFTQGLMTLTGIVSWGRECAMKEKPGVYTRVSSFLPWIH
THIGGENGLAL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagactcctgctggcatgcctgctcctctgcgccctggtcgtgagagactccgagggc
agccacgaacttcatcaagtgtctggtgcatcgaagtgtggctgtctgaatggagggaaa
tgtgtgtcctacaagtacttctccaacattcaacgatgcaactgcccaaagaaattccaa
ggggaacactgtgagatagatacatcgaaaacctgctatcaggggaatggtcactcttac
cgagggaaggccaacactgacaccagtggccggccctgcctggcctggaactctcccacc
atccttctgaaaacgtaccatgcccacagacctgatgcccttcagctgggactggggaaa
cacaattactgcaggaacccagacaatcagaggagaccctggtgctatgtgcacgttggc
ctaatgcagattgtccaggagtgcatggtgcacagctgctcttctggaaaaagtgccctc
tctcctccagaaaagttacagtgcggccagaaggctctgaggccccgctttaagattgtt
gggggagaattcaccaccatcgagaaccagccttggtttgcagccatctataggaggcac
cgtgcaggctctgtcacctacgtgtgcggtggcagcctcatcagtccctgctgggtggtc
agtgccacacactgcttcattgaataccaaaagaaggaggactacattgtctacctgggt
cggtcaaagcttaactccatcacgcctggcgagatgcagtttgaggtgcaaaagctcatc
ttacatgaggactacagtgctgacacccttgctcaccacaatgatattgccttgctgaag
atccgttccagcacaggccaatgtgcacagccatcccggtccatacaggtcatctgcctg
cccccagcgaatggggatgcccgttttggtacaagctgtgaggttactggctttggaaaa
gagaatccctctgactatatctatccagagcagctgaaaatgactgctgtgaagctggtt
tcccacgaggagtgtcagcagccccactactatggcactgaagtcaccagcaaaatgctg
tgtgcggctgacccacagtgggaaacagattcctgccagggagactcaggggggccgctg
gtctgcttcacccaaggcctcatgactctgactgggattgtgagctggggccgtgaatgt
gccatgaaggaaaagccaggcgtctacacaagggtctcaagcttcctgccctggatccac
actcacattgggggggagaatggcctagccctctga

DBGET integrated database retrieval system