KEGG   Delphinapterus leucas (beluga whale): 111183572
Entry
111183572         CDS       T05885                                 

Gene name
NRG3
Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform isoform X2
  KO
K05457  neuregulin 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111183572 (NRG3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111183572 (NRG3)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111183572 (NRG3)
SSDB
Motif
Pfam: EGF LapA_dom Laminin_EGF EGF_2
Other DBs
NCBI-GeneID: 111183572
NCBI-ProteinID: XP_022446732
UniProt: A0A2Y9PTT1
LinkDB
Position
Unknown
AA seq 725 aa
MSEGAAAASPPGAASAAAASAEEGTAAAVAAAAAAAAAAGGGPDGGGEGAAEPPRELRCS
DCIVWNRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFL
SKPSSFPKAMETTTTTTSTTSPATSAGSAASSRTPNRISTRLTTITRAPTRFPGQRVPIR
ASPRSTTARNTAAPSTVLSTTAPFFGSSTPGSRPPVPGTPSTPAMPSWPTAAYATSSYLH
DSTPSWTLSPFQDAASSSSSSSSSSSTTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDL
AYCLNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEE
VYQRQVLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKEPHHGKNYSLKASSTMAK
SENLVKNHVQLQNYSKAERHPVTALEKMMESSFAGPQSFPEVPSPNRGSQSVKHHRTLSS
CCSPGQRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRVPDQDTIPCQGIEVRKTI
SHLPIQLWCVERSLDLKYSSSGLTTQQNASINMQLPSRETNSYFNSLDQTDLMGYSSPRA
SSVPIIPSVGLEETCMQMPGISEVKSIKWCKNSYSADIVNVSIPVSDCLIAEQQEVKILL
ETVQEQIRILTGARRSEDYELASVETEDSTSENTAFLPLSSTAKSEREARFVLRNEIQRD
PALTK
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgagtgaaggggcggccgctgcctcgccacctggagccgcttcggcagccgccgcctcg
gccgaggagggcaccgcggcggctgtggctgcggcggcggcggcggcggcggcggcgggc
gggggcccggacggcggcggcgaaggggcggccgagcccccccgggagttacgctgtagc
gactgcatcgtgtggaaccggcagcagacgtggctgtgcgtggtgcctctgttcatcggc
ttcatcggcctggggctcagcctcatgctgctcaaatggatcgtggtgggctccgtcaag
gaatacgtgccgaccgacctggtggactccaaggggatgggccaggaccccttcttcctc
tccaagcccagctccttccccaaggccatggagaccaccaccacgaccacttccaccacg
tctccagccacctccgccggcagcgccgcctcttccaggacgcccaaccggattagcacc
cggctgaccaccatcacgcgggcgcccactcgcttccccgggcagcgggtgcccatccgg
gccagcccgcgctccaccacggcacggaacactgcggccccctcgacggtcttgtccacg
acagcccctttcttcggtagcagcactccgggctcccgacccccggtgccaggaaccccc
agtaccccggccatgccctcctggcccactgcggcatacgctacctcctcctaccttcat
gattcgactccctcctggaccctgtctccctttcaggatgctgcctcctcctcttcctcc
tcctcgtcttcctcctctaccaccaccacgccagaaactagcaccagccccaaatttcat
acgacgacatattccactgagcggtctgagcacttcaaaccctgccgagacaaggacctt
gcctactgtctcaatgatggcgagtgctttgtgattgaaaccttgactggatcccataaa
cactgtcggtgcaaagaaggctaccaaggagtccgttgtgatcaatttctgccgaaaact
gattccatcttatcggatccaacagaccacttggggattgaattcatggagagtgaagaa
gtttatcagaggcaggtgctgtcaatttcatgtatcatctttggaattgtcatcgtgggc
atgttctgtgcagcattctacttcaaaagcaagaaacaagctaaacaaattcaagagcaa
ctgaaggagccacatcacggtaaaaactacagtctcaaagcatccagcacaatggcaaag
tcagagaacttggtgaagaatcatgtccagctgcaaaactattcaaaggcggaaaggcat
cccgtgactgcattggagaaaatgatggagtcaagttttgccggcccccaatcattccca
gaggtcccttctcccaacagaggaagccaatctgtcaaacaccacaggactctctcctct
tgctgcagcccagggcaaaggagtggtatgctccataggaatgccttcagaaggacaccc
ccctcaccccgaagtaggttgggcggaatcgtgggaccagcatatcagcaactcgaggaa
tcaagggtcccagaccaggatacgataccttgccaagggatagaggtcaggaagactata
tcccacctgcctatacagctgtggtgtgttgaaagatccctggacttaaagtattcgtcc
agtggtttaacaacccaacaaaatgcatcaataaatatgcaactgccttcgagagagaca
aactcctattttaatagcttggatcaaacggacctgatgggatattcatccccaagggcc
agttccgtgcccatcatcccctcagtgggtctagaggaaacctgcatgcaaatgccaggg
atttctgaagtcaaaagcatcaaatggtgcaaaaactcctactctgctgatattgtcaat
gtgagtattccagtcagcgattgtcttatagcagaacagcaagaagtgaaaatactgcta
gaaactgtccaggagcagatccgaattctgactggtgccaggcggtcagaagactacgaa
ctggccagcgtagaaaccgaggacagtacgagtgaaaacacagcctttctccccctgagt
tccacagccaaatcagaacgagaggcccgatttgtcttaagaaatgaaatacaaagagac
cctgcattgaccaagtga

DBGET integrated database retrieval system