KEGG   Delphinapterus leucas (beluga whale): 111183632
Entry
111183632         CDS       T05885                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04218  Cellular senescence
dle04310  Wnt signaling pathway
dle04340  Hedgehog signaling pathway
dle04371  Apelin signaling pathway
dle04390  Hippo signaling pathway
dle04510  Focal adhesion
dle04530  Tight junction
dle04630  JAK-STAT signaling pathway
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111183632 (CCND1)
   04340 Hedgehog signaling pathway
    111183632 (CCND1)
   04390 Hippo signaling pathway
    111183632 (CCND1)
   04371 Apelin signaling pathway
    111183632 (CCND1)
   04630 JAK-STAT signaling pathway
    111183632 (CCND1)
   04068 FoxO signaling pathway
    111183632 (CCND1)
   04151 PI3K-Akt signaling pathway
    111183632 (CCND1)
   04152 AMPK signaling pathway
    111183632 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111183632 (CCND1)
   04115 p53 signaling pathway
    111183632 (CCND1)
   04218 Cellular senescence
    111183632 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111183632 (CCND1)
   04530 Tight junction
    111183632 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111183632 (CCND1)
   04921 Oxytocin signaling pathway
    111183632 (CCND1)
   04919 Thyroid hormone signaling pathway
    111183632 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183632 (CCND1)
   05206 MicroRNAs in cancer
    111183632 (CCND1)
   05205 Proteoglycans in cancer
    111183632 (CCND1)
   05203 Viral carcinogenesis
    111183632 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111183632 (CCND1)
   05212 Pancreatic cancer
    111183632 (CCND1)
   05225 Hepatocellular carcinoma
    111183632 (CCND1)
   05226 Gastric cancer
    111183632 (CCND1)
   05214 Glioma
    111183632 (CCND1)
   05216 Thyroid cancer
    111183632 (CCND1)
   05221 Acute myeloid leukemia
    111183632 (CCND1)
   05220 Chronic myeloid leukemia
    111183632 (CCND1)
   05218 Melanoma
    111183632 (CCND1)
   05219 Bladder cancer
    111183632 (CCND1)
   05215 Prostate cancer
    111183632 (CCND1)
   05213 Endometrial cancer
    111183632 (CCND1)
   05224 Breast cancer
    111183632 (CCND1)
   05222 Small cell lung cancer
    111183632 (CCND1)
   05223 Non-small cell lung cancer
    111183632 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111183632 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111183632 (CCND1)
   04934 Cushing syndrome
    111183632 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111183632 (CCND1)
   05162 Measles
    111183632 (CCND1)
   05160 Hepatitis C
    111183632 (CCND1)
   05163 Human cytomegalovirus infection
    111183632 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111183632 (CCND1)
   05169 Epstein-Barr virus infection
    111183632 (CCND1)
   05165 Human papillomavirus infection
    111183632 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111183632 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111183632
NCBI-ProteinID: XP_022446856
UniProt: A0A2Y9PNM2
LinkDB
Position
Unknown
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELVLVNKLKWNLAATTPHDFIEHFLSKMPVVEESKQVIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSANSFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEGEEEEEADLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgta
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtcgcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gagctggtcttggtgaacaaactcaagtggaacctggctgccacgaccccgcacgacttc
attgaacacttcctctccaaaatgccggtggtcgaggagagcaaacaggtcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaacccgccc
tccatggtggctgccgggagcgtggtggccgcggtgcaaggcctgcacctgggaagcgcc
aacagcttcctgtcctatcaccgcctgacgcggttcctctccaaagtgatcaggtgtgac
ccggactgcctccgcgcctgccaggagcagatcgaggccctcctggagtccagcctgcgc
caggcccagcaacagaacttggaccccaaggccgcggaggagggggaggaggaggaggag
gcggacctggcctgcacgcccaccgacgtgcgcgacgtggacatttga

DBGET integrated database retrieval system