KEGG   Delphinapterus leucas (beluga whale): 111183745
Entry
111183745         CDS       T05885                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01523  Antifolate resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04064  NF-kappa B signaling pathway
dle04066  HIF-1 signaling pathway
dle04071  Sphingolipid signaling pathway
dle04137  Mitophagy - animal
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04218  Cellular senescence
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04917  Prolactin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04926  Relaxin signaling pathway
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05030  Cocaine addiction
dle05132  Salmonella infection
dle05133  Pertussis
dle05134  Legionellosis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05212  Pancreatic cancer
dle05215  Prostate cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05222  Small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111183745 (RELA)
   04014 Ras signaling pathway
    111183745 (RELA)
   04064 NF-kappa B signaling pathway
    111183745 (RELA)
   04668 TNF signaling pathway
    111183745 (RELA)
   04066 HIF-1 signaling pathway
    111183745 (RELA)
   04071 Sphingolipid signaling pathway
    111183745 (RELA)
   04024 cAMP signaling pathway
    111183745 (RELA)
   04151 PI3K-Akt signaling pathway
    111183745 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111183745 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    111183745 (RELA)
   04218 Cellular senescence
    111183745 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111183745 (RELA)
   04621 NOD-like receptor signaling pathway
    111183745 (RELA)
   04622 RIG-I-like receptor signaling pathway
    111183745 (RELA)
   04623 Cytosolic DNA-sensing pathway
    111183745 (RELA)
   04625 C-type lectin receptor signaling pathway
    111183745 (RELA)
   04660 T cell receptor signaling pathway
    111183745 (RELA)
   04658 Th1 and Th2 cell differentiation
    111183745 (RELA)
   04659 Th17 cell differentiation
    111183745 (RELA)
   04657 IL-17 signaling pathway
    111183745 (RELA)
   04662 B cell receptor signaling pathway
    111183745 (RELA)
   04062 Chemokine signaling pathway
    111183745 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111183745 (RELA)
   04917 Prolactin signaling pathway
    111183745 (RELA)
   04926 Relaxin signaling pathway
    111183745 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111183745 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111183745 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    111183745 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183745 (RELA)
   05202 Transcriptional misregulation in cancer
    111183745 (RELA)
   05203 Viral carcinogenesis
    111183745 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111183745 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111183745 (RELA)
   05221 Acute myeloid leukemia
    111183745 (RELA)
   05220 Chronic myeloid leukemia
    111183745 (RELA)
   05215 Prostate cancer
    111183745 (RELA)
   05222 Small cell lung cancer
    111183745 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111183745 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111183745 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    111183745 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111183745 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111183745 (RELA)
   04931 Insulin resistance
    111183745 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111183745 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111183745 (RELA)
   05135 Yersinia infection
    111183745 (RELA)
   05133 Pertussis
    111183745 (RELA)
   05134 Legionellosis
    111183745 (RELA)
   05152 Tuberculosis
    111183745 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111183745 (RELA)
   05170 Human immunodeficiency virus 1 infection
    111183745 (RELA)
   05162 Measles
    111183745 (RELA)
   05164 Influenza A
    111183745 (RELA)
   05161 Hepatitis B
    111183745 (RELA)
   05160 Hepatitis C
    111183745 (RELA)
   05168 Herpes simplex virus 1 infection
    111183745 (RELA)
   05163 Human cytomegalovirus infection
    111183745 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111183745 (RELA)
   05169 Epstein-Barr virus infection
    111183745 (RELA)
   05165 Human papillomavirus infection
    111183745 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111183745 (RELA)
   05145 Toxoplasmosis
    111183745 (RELA)
   05140 Leishmaniasis
    111183745 (RELA)
   05142 Chagas disease
    111183745 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111183745 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111183745 (RELA)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    111183745 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 111183745
NCBI-ProteinID: XP_022447166
UniProt: A0A2Y9PPK8
LinkDB
Position
Unknown
AA seq 562 aa
MWACADPCLLLLSDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGE
RSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRC
IHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPVEEQRGDYDLNAVRLCFQVTVRDPA
GRPLRLSPALSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFT
GPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYL
PDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDHRPPTRRIAVPSRSSTSVPKPPPQPY
PFTPSLSTINFEEFSPMVFPSGQIPSQTSALAPAPALVLAQAPAPAPAMASALAQAPAPG
PVLAPGLAQAVTPPAPKTNPAGEGTLTEALLQLQFDADEDLGALLGSSTDPAVFTDLASV
DNSEFQQLLNQGVPLAPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLS
GDEDFSSIADMDFSALLSQISS
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgtgggcttgtgctgacccttgtctccttctcctttcagacctcttccccctcatcttc
cccgcggagccggcccaggcctccggcccctacgtggagatcatcgagcagcccaagcag
cggggcatgcgctttcgctacaagtgtgagggccgctcagcaggcagtatcccaggcgag
aggagcacagataccaccaagacccaccctaccatcaagatcaatggttacacggggcca
gggacagtccgcatttccctggtgaccaaggacccccctcaccggcctcacccccatgag
cttgtggggaaagactgccgggatggcttctatgaggctgagctctgcccggaccgctgc
atccacagcttccagaacctggggatccagtgtgtaaagaagcgggacctggagcaggcc
atcagtcagcgcatccagaccaacaacaaccccttccaagttcccgtagaagagcagcgt
ggggactacgacctgaatgctgtccggctctgcttccaggtgacagtgcgggacccggca
ggcaggcccctacgcctgtcgcctgccctctctcatcccatctttgacaaccgcgccccc
aacactgccgagctcaagatctgccgagtgaatcggaactctgggagctgccttgggggg
gatgagatcttcctgctgtgtgacaaggtgcagaaagaggatatcgaggtgtatttcacg
ggaccaggctgggaggcccgaggctccttttcacaagctgatgtgcaccggcaagtggcc
attgtgttccggacgcccccctacgcggaccccagcctgcaggcccccgtgcgcgtctcc
atgcagctgcggcggccttccgatcgggagctcagcgaacccatggaattccagtacttg
ccagacacagatgatcgtcaccggattgaggagaaacgcaaaaggacatatgagaccttt
aagagcatcatgaaaaagagccctttcaatggacccaccgaccaccggcctccgacccgg
cgcatcgctgtgccttcccgcagctcaacttccgtccccaagccacctccccagccctat
ccctttacaccatctctcagcaccatcaactttgaggagttctcccccatggtctttcct
tctgggcagatcccaagccagacctcggccttggcaccggcccctgccctagtcctggcc
caggccccagcccctgccccagccatggcatcagccctggcccaggccccagcccctggc
ccagtcctagccccaggccttgctcaggctgtgaccccacctgcccccaagactaaccca
gctggggaagggacgctgacagaggctctgctgcagctgcagtttgatgctgatgaagac
ctgggggccctgctcggcagtagcacagatccagccgtgttcacggacctggcatccgtc
gacaactctgagttccagcagctgctgaaccagggtgtgcccctggccccccatacagct
gagcccatgctgatggagtaccctgaggctataactcgtctggtgacagggtcccagagg
ccccctgacccagctcccactcccctgggagcctctggcctcaccaacggcctcctctca
ggggatgaagacttctcctccattgcggacatggacttctcagcccttctgagtcagatc
agctcctaa

DBGET integrated database retrieval system