KEGG   Delphinapterus leucas (beluga whale): 111183810
Entry
111183810         CDS       T05885                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04140  Autophagy - animal
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04370  VEGF signaling pathway
dle04510  Focal adhesion
dle04722  Neurotrophin signaling pathway
dle04910  Insulin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle05010  Alzheimer disease
dle05014  Amyotrophic lateral sclerosis
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05165  Human papillomavirus infection
dle05168  Herpes simplex virus 1 infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
dle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111183810 (BAD)
   04014 Ras signaling pathway
    111183810 (BAD)
   04370 VEGF signaling pathway
    111183810 (BAD)
   04024 cAMP signaling pathway
    111183810 (BAD)
   04022 cGMP-PKG signaling pathway
    111183810 (BAD)
   04151 PI3K-Akt signaling pathway
    111183810 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111183810 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    111183810 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111183810 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111183810 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111183810 (BAD)
   04919 Thyroid hormone signaling pathway
    111183810 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111183810 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183810 (BAD)
   05203 Viral carcinogenesis
    111183810 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111183810 (BAD)
   05212 Pancreatic cancer
    111183810 (BAD)
   05225 Hepatocellular carcinoma
    111183810 (BAD)
   05221 Acute myeloid leukemia
    111183810 (BAD)
   05220 Chronic myeloid leukemia
    111183810 (BAD)
   05218 Melanoma
    111183810 (BAD)
   05211 Renal cell carcinoma
    111183810 (BAD)
   05215 Prostate cancer
    111183810 (BAD)
   05213 Endometrial cancer
    111183810 (BAD)
   05223 Non-small cell lung cancer
    111183810 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111183810 (BAD)
   05014 Amyotrophic lateral sclerosis
    111183810 (BAD)
   05020 Prion disease
    111183810 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    111183810 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111183810 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111183810 (BAD)
   05161 Hepatitis B
    111183810 (BAD)
   05160 Hepatitis C
    111183810 (BAD)
   05162 Measles
    111183810 (BAD)
   05168 Herpes simplex virus 1 infection
    111183810 (BAD)
   05165 Human papillomavirus infection
    111183810 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111183810 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111183810 (BAD)
   01524 Platinum drug resistance
    111183810 (BAD)
   01522 Endocrine resistance
    111183810 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 111183810
NCBI-ProteinID: XP_022447335
UniProt: A0A2Y9PW98
LinkDB
Position
Unknown
AA seq 168 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKHRQTAPGLLGEAGHQQGQPASSSH
HGGTGAVETRSRHSSYSAGTEDEEGTEEEEPSPFRGRSRSAPPNLWAARRYGRELRRMSD
EFHGSFKGLPRPNSAGTATQMRQSPSWTRFLQSWWNRNLGRGGPAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggacaggcccccaggtcccagcaagcaccggcaaacg
gccccaggcctcctgggggaagctggtcaccagcaggggcagccagccagcagcagccac
catggaggcactggggctgtggagacccggagtcgccacagctcctactccgcggggacg
gaggatgaagaagggacggaggaggaggagcccagccccttccggggccgctcgcgctcg
gcgccccccaacctctgggctgcacggcgatatggccgcgagctccggaggatgagcgac
gagttccacggctccttcaagggacttcctcgcccgaacagcgcgggcacggcgacgcag
atgcgacaaagccccagctggacgcgcttccttcagtcctggtggaaccggaacttgggg
agaggaggccccgccccctcccagtga

DBGET integrated database retrieval system