KEGG   Delphinapterus leucas (beluga whale): 111183892
Entry
111183892         CDS       T05885                                 

Gene name
DDB1
Definition
(RefSeq) DNA damage-binding protein 1
  KO
K10610  DNA damage-binding protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03420  Nucleotide excision repair
dle04120  Ubiquitin mediated proteolysis
dle05161  Hepatitis B
dle05170  Human immunodeficiency virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111183892 (DDB1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    111183892 (DDB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111183892 (DDB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111183892 (DDB1)
   05161 Hepatitis B
    111183892 (DDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111183892 (DDB1)
   03400 DNA repair and recombination proteins [BR:dle03400]
    111183892 (DDB1)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     111183892 (DDB1)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      111183892 (DDB1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      111183892 (DDB1)
SSDB
Motif
Pfam: MMS1_N CPSF_A Beta_propel IQCJ-SCHIP1
Other DBs
NCBI-GeneID: 111183892
NCBI-ProteinID: XP_022447542
UniProt: A0A2Y9PW42
LinkDB
Position
Unknown
AA seq 1140 aa
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRE
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QDPKALVSEWKEPQGKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVAC
LDITPLGDSSGMSPLCAIGLWTDISARIAKLPSFELLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCRLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgtcgtacaactacgtggtaacggcacagaagcccaccgccgtgaacggctgcgtgacc
ggacactttacttcagctgaagacttgaacctgttgattgccaaaaatacgagattagag
atctatgtggtcactgctgaggggcttcgacccgtcaaagaggtgggcatgtatgggaag
attgctgtcatggagcttttcaggcccaagggggagagcaaggacctactgtttatcctg
acagctaagtacaatgcctgcatcttggagtataagcagagtggcgagagcattgacatc
ataacgcgagctcatggcaatgtccaggaccgaattggccgcccctcagagacgggcatt
attggcatcattgaccctgagtgccgaatgattggcctgcgactctatgatggccttttc
aaggttattccactagaccgggacaataaagagctcaaggcctttaacatccgcctggag
gagttgcatgttattgatgtcaagttcctatatggttgccaagcacctaccatctgcttt
gtctaccaggaccctcaggggcggcacgtaaaaacctatgaggtgtctctccgagagaag
gagttcaataagggcccttggaaacaggaaaacgtagaagctgaagcttccatggtgatt
gcagtcccagagccttttggaggcgccatcatcattggacaggaatcaatcacctatcac
aacggtgacaaatatctggcgattgcccctcccatcattaagcaaagcacaattgtgtgt
cacaatcgcgtggaccccaatggctcccgctatctgctgggagacatggaaggacggctc
ttcatgctgcttttggagaaggaggaacagatggatggcaccgttaccctcaaggatctc
cgagtggaactccttggggagacctctattgctgagtgcttgacataccttgataacggt
gttgtgtttgtcgggtctcgccttggtgactcccagcttgtgaagctcaatgttgacagc
aatgaacaaggctcctatgtagtggccatggaaacctttaccaatttaggacccattgtg
gacatgtgtgtggtggacctggagaggcaggggcagggacagctggtcacttgctctggg
gctttcaaggaaggctctttgcggatcatccggaatggaattggaatccacgagcatgcc
agcattgacttgccaggcatcaaaggcttatggcccctgcggtctgatcctaatcgggag
actgatgacactttggtgctctcttttgtgggccaaacgagagttctcatgttaaacgga
gaggaggtggaagaaactgaactgatgggttttgtggacgatcagcagactttcttctgt
ggcaatgtggctcatcaacaactcatccagatcacttcagcatctgtgaggttggtctct
caagaccctaaagctctcgtcagtgagtggaaggagcctcagggcaagaacatcagtgtg
gcctcctgcaatagcagccaggtagtagtagccgtgggaagggccctctactacctgcag
atccatcctcaggagctccgacagatcagccacacagagatggaacacgaagtggcctgc
ttggacatcacccctttaggggacagcagtggaatgtcccctctttgtgctattggtctc
tggacagacatctcagcccgaatcgcgaagctgccctcttttgagctactgcacaaagag
atgctgggtggagagatcattcctcgttctatcctgatgaccacctttgagagtagccac
tacctcctttgtgccttgggagatggggcgcttttctactttgggctcaacatcgagaca
ggcctgttgagcgaccgtaagaaggtgactctgggcacccagcccaccgtattgaggact
ttccgttctctttctaccaccaacgtctttgcttgctctgaccgccccactgtcatctac
agcagcaaccacaaattggtcttctccaacgtcaacctcaaggaggtgaactacatgtgt
cccctcaactcagatggctaccctgacagcctggcactggccaacaacagcaccctcacc
attggcaccattgacgagatacagaagctgcacattcgtacggttcccctctatgaatct
cccaggaagatttgctaccaggaggtgtcccagtgcttcggggtcctctccagccgtatt
gaagtccaggacacgagtgggggcacaactgctctgaggcccagcgccagcacccaggcc
ctgtccagcagcgtcagctccagcaagctgttctccagcagcacagcccctcacgagacc
tcctttggagaagaggtggaggtgcataacctccttatcattgaccagcacacctttgaa
gtgctccacgcccaccagttcctgcagaacgagtatgccctcagcctggtctcctgcagg
ttgggcaaagaccccaacacatacttcatcgtgggcacggccatggtgtaccctgaagag
gcagagcccaagcagggtcgtattgtggtctttcagtattcagatggaaaactacagact
gtggctgaaaaggaggtgaaaggggctgtgtactctatggtggaatttaacgggaagttg
ttagccagcatcaacagcacggtgcggctttacgagtggacgacggagaaggagctccgc
accgagtgcaaccactacaacaacatcatggccctgtacctgaagaccaagggcgacttc
atcctggtgggcgacctgatgcgctcggtgctgctgctggcctacaagccaatggagggc
aacttcgaagagattgctcgagactttaaccccaactggatgagtgctgtggaaatcttg
gatgatgacaatttcctgggggctgaaaatgcctttaacttgtttgtgtgtcagaaggat
agcgctgccaccactgatgaggagcggcagcacctccaggaggttgggctcttccacttg
ggcgagtttgtcaacgtcttttgccacggctctctggtcatgcagaatctgggcgagacc
tccacccctacccagggctcagtgctcttcggcacggtcaacggcatgattggcctcgtg
acctcactgtcagagagctggtacaacctcttgttggacatgcagaatcgactcaataaa
gtcatcaaaagtgtgggcaagattgaacactccttctggagatcctttcatactgaacgc
aagacagaaccagccacaggcttcatcgatggggacttgattgagagtttcctggacatc
agccggcccaagatgcaggaggttgtggcaaacctgcagtatgacgatggcagtggaatg
aagcgagaagccactgcggatgacctgatcaaggttgtggaggagttaactcggatccat
tag

DBGET integrated database retrieval system