KEGG   Delphinapterus leucas (beluga whale): 111183967
Entry
111183967         CDS       T05885                                 

Gene name
NR1H3
Definition
(RefSeq) oxysterols receptor LXR-alpha isoform X1
  KO
K08536  liver X receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03320  PPAR signaling pathway
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    111183967 (NR1H3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111183967 (NR1H3)
   04931 Insulin resistance
    111183967 (NR1H3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111183967 (NR1H3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111183967 (NR1H3)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dle03310]
    111183967 (NR1H3)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    111183967 (NR1H3)
Nuclear receptors [BR:dle03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   111183967 (NR1H3)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 111183967
NCBI-ProteinID: XP_022447760
UniProt: A0A2Y9PPY7
LinkDB
Position
Unknown
AA seq 447 aa
MSLWLEAPVPDVSPDCAVELWEPDARDASSQPLGSSNCILREESSTPQSAGGTSRVGLEA
TESTALLPGVEAPPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYICHSGGHCPMDTYMRRKCQECRLRKCREAGMREECVLSEEQIRLKKLK
RQEEEQAQATSVSPRASSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVNLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtctttgtggctggaggcccctgtgcctgatgtttctcctgactgtgcagtggagctg
tgggagccagatgcacgagatgcaagcagccagcctctgggaagcagcaactgtatcctc
agggaggaatctagcacaccccaatctgctgggggcacttcacgggtggggctggaggca
acagagtccacagccctgctccccggggtggaggcccctccagagtccacagagcttcgt
ccacaaaagcggaaaaaggggccagcccccaaaatgctcgggaatgagctgtgcagtgtg
tgtggggacaaggcttccggcttccactacaacgtgctgagctgcgagggctgcaaggga
ttcttccgccgcagtgtcatcaaaggggcgcgctacatctgccacagtgggggccactgc
cccatggacacctacatgcgtcgcaagtgccaggagtgccgccttcgcaaatgccgcgag
gccggcatgcgggaggagtgtgttctgtcagaagaacagatccgtctgaagaaactgaag
cggcaagaggaggaacaggctcaggccacatccgtgtccccgagggcttcctctccgccc
caagtcctgccccagctcagcccggagcagctgggcatgattgagaagctggtggctgcc
cagcagcagtgtaacagacgttccttctcagaccggcttcgagtcacgccttggcccatg
gcaccagacccccagagtcgggaggcccgtcagcaacgctttgcccacttcacggagctg
gccattgtctctgtgcaggagatcgttgactttgccaaacagctgccgggcttcctgcag
ctcagccgggaggaccagattgccctcctgaagacctctgcaattgaggtgatgcttctg
gagacatctcggaggtacaaccctggcagtgagagtattaccttcctcaaggatttcagt
tataaccgggaagactttgccaaagcagggctgcaggtggagttcatcaaccccatcttt
gagttctccagagccatgaatgagctgcaactaaatgatgctgagtttgccttgctcatt
gccatcagcatcttctctgcagaccggcccaacgtgcaggaccagctccaggtagagagg
ctgcaacacacatatgtggaggccctgcatgcctacgtctccatccaccacccccatgac
cgactcatgtttccacggatgctaatgaaactggtgaacctccggacactgagcagtgtc
cattcagagcaagtatttgcgctgcgcctgcaggataaaaagcttcccccgctgctctct
gagatctgggatgtgcacgagtga

DBGET integrated database retrieval system