KEGG   Delphinapterus leucas (beluga whale): 111183968
Entry
111183968         CDS       T05885                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03420  Nucleotide excision repair
dle04115  p53 signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle05161  Hepatitis B
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111183968 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    111183968 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111183968 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183968 (DDB2)
   05202 Transcriptional misregulation in cancer
    111183968 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111183968 (DDB2)
   05212 Pancreatic cancer
    111183968 (DDB2)
   05225 Hepatocellular carcinoma
    111183968 (DDB2)
   05226 Gastric cancer
    111183968 (DDB2)
   05214 Glioma
    111183968 (DDB2)
   05216 Thyroid cancer
    111183968 (DDB2)
   05220 Chronic myeloid leukemia
    111183968 (DDB2)
   05217 Basal cell carcinoma
    111183968 (DDB2)
   05218 Melanoma
    111183968 (DDB2)
   05213 Endometrial cancer
    111183968 (DDB2)
   05224 Breast cancer
    111183968 (DDB2)
   05222 Small cell lung cancer
    111183968 (DDB2)
   05223 Non-small cell lung cancer
    111183968 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111183968 (DDB2)
   05169 Epstein-Barr virus infection
    111183968 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111183968 (DDB2)
   03400 DNA repair and recombination proteins [BR:dle03400]
    111183968 (DDB2)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     111183968 (DDB2)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      111183968 (DDB2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 111183968
NCBI-ProteinID: XP_022447768
UniProt: A0A2Y9PWQ5
LinkDB
Position
Unknown
AA seq 457 aa
MAPRKRPETQKTPEVVVRPKSKRNRSPWELEPEAKKLCLKGPGPSRRFDSGCLWAGLASL
RVPPPCSIVRALHQHKLGTAAWPSLQQGLQQSFLNSLASYRIFQKAAPFDRRATSLAWHP
THPSTLAVGSKGGDILLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFFTSSMEGTT
RLQDFKGNTLRVFASSGTCNFWFCSLDVSVRSRVVVTGDNVGNVILLNMDGRELWNLRMH
KKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKSSFLYSLLHRHPVNAAHFSPDGA
QLLTTDQKSEIRVYSASQWDCPPSLIPHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPNF
KSCTSHELRTIDVFDGSSGKMMYQLYDPESSGIMSVRLGPSNNNGRKQGFTLPYWIKNDQ
KLILMCPSPSTLIPSSCLSPCLCSSMSSIPWGTHWPL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacgcccagaaacccagaagacccccgaggtggttgtgcgccccaag
agcaagaggaacagaagcccctgggagctggaacccgaggccaagaagctctgtttgaag
ggccccggtcctagcagaagatttgactcaggctgcctttgggcggggttggctagcctg
cgggtcccgccaccatgcagcatcgtcagggccctccaccagcataagctgggcacagct
gcctggccatcactacagcagggtctccagcagtcctttttgaactctctggcttcttac
cggatattccaaaaggctgccccttttgacaggagggccacatccctggcgtggcaccca
actcaccccagcaccctggctgtgggttccaaagggggagatatcttgctctggaacttt
ggcataaaggacaaacccaccttcattaaagggattggagctggagggagcatcactggg
ctgaagtttaaccctctcaataccaaccagtttttcacctcctcaatggagggaacaact
aggctgcaagactttaaaggcaacactctccgagtttttgccagctcaggcacctgcaac
ttctggttttgcagcctggatgtgtctgtcagaagccgagtggtggtcacaggagataac
gtggggaacgtgatcctgctgaacatggacggcagggagctttggaatctgagaatgcac
aaaaagaaagtgacccacgtggccctgaacccgtgctgtgattggttcctggccacagcc
tccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaatccagcttc
ctctactcgctgctgcacaggcatcccgtcaacgcagctcatttcagtcctgacggtgcc
cagctcctgaccactgaccagaaaagtgagatccgtgtttactctgcctcccagtgggac
tgccccccaagcctgatcccacaccctcatcgccacttccagcacctgacacccatcaag
gcaacctggcatcctcggtacaacctcattgtcgtgggccgatacccagatcctaatttc
aaaagttgtacctcccatgaattaaggacgatcgatgtgtttgacggaagctcaggaaag
atgatgtatcagctgtatgacccagaatcttctggtatcatgtcggtgaggcttgggccc
tcaaataataatgggaggaagcagggattcaccttaccttactggatcaaaaatgaccag
aaattaatccttatgtgcccttctcccagtaccctcattccctcctcatgcttatcccct
tgtctctgcagctcaatgagttcaatcccatgggggacacactggcctctgtga

DBGET integrated database retrieval system