KEGG   Delphinapterus leucas (beluga whale): 111184015Help
Entry
111184015         CDS       T05885                                 

Gene name
HSD17B12
Definition
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase isoform X1
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00062  Fatty acid elongation
dle00140  Steroid hormone biosynthesis
dle01040  Biosynthesis of unsaturated fatty acids
dle01100  Metabolic pathways
dle01212  Fatty acid metabolism
Module
dle_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    111184015 (HSD17B12)
   00140 Steroid hormone biosynthesis
    111184015 (HSD17B12)
   01040 Biosynthesis of unsaturated fatty acids
    111184015 (HSD17B12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dle01004]
    111184015 (HSD17B12)
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     111184015 (HSD17B12)
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     111184015 (HSD17B12)
Lipid biosynthesis proteins [BR:dle01004]
 Fatty acid synthase
  Component type
   111184015 (HSD17B12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 TrkA_N 3HCDH_N Epimerase GDP_Man_Dehyd Phage_int_SAM_3 NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 111184015
NCBI-ProteinID: XP_022447918
UniProt: A0A2Y9PXS1
LinkDB All DBs
Position
Unknown
AA seq 348 aa AA seqDB search
MESALPAAGFLYWVGAGTVAYLALRISCSLFTVLRVWGLGHEPGVGPGLGEWAGFQKNDQ
HVHGESVWPWRREPYHQRSTSIGIPGRETVVTGSTDGIGKSYAEELAKRGMKIVLISRSQ
DKLNQVSSEIREKFKVETKTIAVDFASEDIYDKIKTSLAGLEIGVLVNNVGMSYEYPEYF
LDVPDLDSTIKKLINVNVLSVCKMTWLVLPGMVERSKGAILNISSASGMYPVPLLTLYSA
TKAFVDFFSRCLHEEYKSKGIFVQSVLPYFVATKLAKIRKPTLDKPSSETFVKSAIKTVG
VQSRTNGYLIHSLMASVISSLPSWLYFKLTMNLGNSTRARYLKKIKKN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgctctgcctgccgccggcttcctatactgggtgggcgcgggcaccgtggcc
tacctggctctgcgcatctcgtgctcgctcttcacggtccttcgggtctggggtttgggt
cacgagccgggggtcggaccggggctcggtgaatgggcaggtttccaaaaaaacgaccag
catgtacacggtgagtcagtatggccttggcgaagggagccttatcatcaaaggagcacc
agcattggcatcccaggaagggagacagttgtcacgggtagtactgatggaattggaaaa
tcatatgcagaagagttagcaaagcgtggaatgaagattgtccttatcagcagatcacag
gacaaactgaaccaggtttccagtgaaataagagaaaaattcaaagtggaaacaaagacc
attgctgttgactttgcatcggaagatatttatgataaaattaaaacaagcttggcaggt
cttgaaattggtgttttagtgaacaatgtgggaatgtcatatgagtatccggaatacttt
ttggatgttcctgacttggacagtaccatcaagaaactgataaatgttaatgttctttct
gtttgcaagatgacatggttggtactgcctggcatggtagaaagatctaaaggggcaatt
ctgaacatctcctctgccagtggcatgtacccagttccactgttgaccttgtactctgca
actaaggcttttgtagatttcttctctagatgcctccatgaagaatataagagcaagggc
atctttgtgcagagtgtcctgccctactttgtagctacgaagctggctaaaattcgaaag
ccaactttggataagccctcttcagagacgtttgtgaagtctgccattaaaaccgtcggc
gtgcaatcccgaaccaacggatacctgatccattctcttatggcctcagtaatctcaagc
ctgccttcctggttgtattttaaattgaccatgaatttaggcaactccacccgggctcgc
tatctgaagaaaattaagaagaactaa

DBGET integrated database retrieval system