KEGG   Delphinapterus leucas (beluga whale): 111184141
Entry
111184141         CDS       T05885                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine-protein kinase 4 isoform X1
  KO
K04411  serine/threonine kinase 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04068  FoxO signaling pathway
dle05200  Pathways in cancer
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111184141 (STK4)
   04014 Ras signaling pathway
    111184141 (STK4)
   04068 FoxO signaling pathway
    111184141 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184141 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111184141 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111184141 (STK4)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE20 family
   111184141 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase DUF4611
Other DBs
NCBI-GeneID: 111184141
NCBI-ProteinID: XP_022448022
UniProt: A0A2Y9PXE7
LinkDB
Position
Unknown
AA seq 487 aa
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDSFMDFVKQCLIKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTMSDGANTMIEHDDT
LPSQLGTMVINSEEEEEEGTMKRRDETMQPARPSFLEYFEQKEKENQINSFGKSVPGPLK
NSSDWKVPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagacggtgcagctcaggaacccgccgcgccggcagctgaaaaagttagatgaagat
agtttaactaaacaaccagaagaagtgtttgatgtcttagagaaacttggagaagggtcc
tatggcagcgtgtacaaagctattcataaagagacaggtcagattgttgctattaagcaa
gttcctgtggagtcagacctgcaggagataatcaaagaaatctctataatgcagcaatgt
gacagccctcacgtagtcaaatactacggcagttattttaagaacacagacttgtggatt
gtgatggagtactgtggggctggttctgtgtctgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacagtcaacacttaagggactggaatacctt
cattttatgagaaaaatacaccgagatatcaaggcaggaaatattttgctaaatacagaa
ggtcatgccaaacttgcagattttggggtagcaggtcagcttacagataccatggccaag
cgaaatacagtgataggaacaccattttggatggctccagaagtgattcaggaaattggg
tacaactgtgtggcagacatctggtcgttgggaataacagccatagaaatggctgaagga
aagcccccatatgccgatatccatcctatgagggcaatcttcatgattcctaccaaccca
cctcccacgttccgaaagccagaactgtggtcagatagcttcatggattttgtgaagcag
tgtctcataaagagccctgagcagagagccacggccactcaactcctacagcacccattt
gtcaagagtgccaaaggagtgtccatactgcgggatttaattaacgaagccatggacgtg
aagctgaaacgccaggaggcccagcagcgggaggtggaccaggacgatgaagaaaactca
gaggaggatgaaatggattctggcacgatggtccgagcagcgggggacgagatgggcact
gtccgagtagccagcaccatgagtgacggggccaatactatgatcgaacatgatgacacg
ttgccatctcagctgggcaccatggtgatcaactcagaggaggaggaagaggaaggcact
atgaaaagaagggatgagaccatgcagcctgcaagaccatctttccttgaatactttgaa
caaaaagaaaaggaaaatcaaatcaacagctttggcaagagtgtccctggcccactgaag
aactcttcagattggaaagttccacaggatggagactatgagttcctgaagagttggacg
gtagaggaccttcagaagaggctcttggccctggaccccatgatggagcaggagattgaa
gagatccggcagaagtaccagtcgaagcggcagcccatccttgatgccattgaggccaag
aagcggcggcagcaaaacttctga

DBGET integrated database retrieval system