KEGG   Delphinapterus leucas (beluga whale): 111184199
Entry
111184199         CDS       T05885                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04015  Rap1 signaling pathway
dle04062  Chemokine signaling pathway
dle04137  Mitophagy - animal
dle04144  Endocytosis
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04510  Focal adhesion
dle04520  Adherens junction
dle04530  Tight junction
dle04540  Gap junction
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04625  C-type lectin receptor signaling pathway
dle04727  GABAergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04810  Regulation of actin cytoskeleton
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle05100  Bacterial invasion of epithelial cells
dle05135  Yersinia infection
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05219  Bladder cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111184199 (SRC)
   04015 Rap1 signaling pathway
    111184199 (SRC)
   04370 VEGF signaling pathway
    111184199 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111184199 (SRC)
   04137 Mitophagy - animal
    111184199 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111184199 (SRC)
   04520 Adherens junction
    111184199 (SRC)
   04530 Tight junction
    111184199 (SRC)
   04540 Gap junction
    111184199 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111184199 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111184199 (SRC)
   04613 Neutrophil extracellular trap formation
    111184199 (SRC)
   04625 C-type lectin receptor signaling pathway
    111184199 (SRC)
   04062 Chemokine signaling pathway
    111184199 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111184199 (SRC)
   04915 Estrogen signaling pathway
    111184199 (SRC)
   04917 Prolactin signaling pathway
    111184199 (SRC)
   04921 Oxytocin signaling pathway
    111184199 (SRC)
   04926 Relaxin signaling pathway
    111184199 (SRC)
   04919 Thyroid hormone signaling pathway
    111184199 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    111184199 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111184199 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    111184199 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111184199 (SRC)
   05203 Viral carcinogenesis
    111184199 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    111184199 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111184199 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111184199 (SRC)
   05152 Tuberculosis
    111184199 (SRC)
   05100 Bacterial invasion of epithelial cells
    111184199 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111184199 (SRC)
   05168 Herpes simplex virus 1 infection
    111184199 (SRC)
   05163 Human cytomegalovirus infection
    111184199 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111184199 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111184199 (SRC)
   01522 Endocrine resistance
    111184199 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111184199 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111184199 (SRC)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111184199 (SRC)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  SRC family
   111184199 (SRC)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    111184199 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    111184199 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    111184199 (SRC)
  Macropinocytosis
   Kinases
    111184199 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 111184199
NCBI-ProteinID: XP_022448165
UniProt: A0A2Y9PSD7
LinkDB
Position
Unknown
AA seq 562 aa
MGSNKSKPKDASQRRRSLEPADNTHGGCGGGGGGGGGGGAFPTSQTPSKPASADGHRGPS
TAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERL
QIVNNTRKVDVSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFG
KITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGG
FYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPMSKPQTQGLAKDAWEIPRESLRLEV
KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSE
EPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAAN
ILVGESLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGIL
LTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEY
LQAFLEDYFTSTEPQYQPGENL
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaagatgccagccagcggcgccgcagcctggaacct
gctgataacacccatggcggctgtggcggcggcggcggcggcggcggcggcgggggtgcc
ttccccacctcacagacccccagcaagccggcctccgctgatggacaccggggccccagc
acggccttcgcccctgcagccgctgagcccaagctgttcggaggtttcaattcctccgac
acagtcacctccccgcagagggcggggcccctggctggcggagtgaccacctttgtggcc
ctctatgactatgagtcgcggacagagaccgacctgtctttcaagaaaggggagcggctc
caaattgtcaacaacacgaggaaggtggatgtcagccagacctggttcacattcagatgg
ctgcaaagagagggagactggtggctggcccactcactcagcacaggacagacgggctat
atccccagcaactacgtcgcaccctccgactccatccaggccgaggagtggtactttggc
aagatcaccagacgggagtcagagcggttactgctcaatgcggagaacccaagagggacc
ttcctagtgcgagaaagtgagaccacgaaaggcgcctactgcctctcagtgtctgacttc
gacaacgccaagggcctcaacgtgaagcactacaagatccgcaagctggacagcggcggc
ttctacatcacctcccgcacccagttcaacagcctgcagcagctcgtggcctactactcc
aaacacgctgacggcctgtgccaccgcctcaccactgtgtgccccatgtccaagccacag
actcagggcctggccaaggacgcctgggagatcccccgggagtcgctgcggctggaggtc
aagctgggccagggctgcttcggagaggtgtggatggggacctggaatggcaccaccagg
gtggccatcaaaactctgaagcccggcacgatgtctccggaggccttccttcaggaggcc
caggtcatgaagaaactgaggcatgagaagctggtgcagctgtacgcggtggtgtctgag
gagcccatctacatcgtcacggagtacatgagcaaggggagtttgctggactttctcaag
ggggagacaggcaagtacctgcggctgcctcagctggtggacatggctgctcagatcgct
tcaggcatggcgtacgtggagcggatgaactatgtccaccgagacctccgcgctgccaac
atcctggttggagaaagcctcgtgtgcaaagtggctgactttgggctggctcggctcatc
gaagacaatgagtacacagcccggcaaggtgccaaattccccatcaagtggacggctcca
gaagctgccctctatggccggttcaccatcaagtcagatgtgtggtcctttgggatcctg
ctgacagagctcacgacaaagggacgggtgccctaccccgggatggtgaaccgcgaggtg
ctggaccaggtggagaggggctaccggatgccctgcccgcccgagtgtcccgagtctctg
catgacctcatgtgccagtgctggcggaaggacccagaggagcggcccacctttgagtac
ctgcaggccttcctggaggactacttcacgtccaccgagccccagtaccagcccggagag
aacctatag

DBGET integrated database retrieval system