Delphinapterus leucas (beluga whale): 111184326 Help Entry 111184326         CDS       T05885                                  Gene name BCL2L1 Definition (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01521   EGFR tyrosine kinase inhibitor resistance dle01524   Platinum drug resistance dle04014   Ras signaling pathway dle04064   NF-kappa B signaling pathway dle04115   p53 signaling pathway dle04137   Mitophagy - animal dle04140   Autophagy - animal dle04151   PI3K-Akt signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04621   NOD-like receptor signaling pathway dle04630   JAK-STAT signaling pathway dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05022   Pathways of neurodegeneration - multiple diseases dle05145   Toxoplasmosis dle05162   Measles dle05166   Human T-cell leukemia virus 1 infection dle05168   Herpes simplex virus 1 infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05202   Transcriptional misregulation in cancer dle05212   Pancreatic cancer dle05220   Chronic myeloid leukemia dle05222   Small cell lung cancer dle05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     111184326 (BCL2L1)    04630 JAK-STAT signaling pathway     111184326 (BCL2L1)    04064 NF-kappa B signaling pathway     111184326 (BCL2L1)    04151 PI3K-Akt signaling pathway     111184326 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111184326 (BCL2L1)    04137 Mitophagy - animal     111184326 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     111184326 (BCL2L1)    04215 Apoptosis - multiple species     111184326 (BCL2L1)    04115 p53 signaling pathway     111184326 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     111184326 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111184326 (BCL2L1)    05202 Transcriptional misregulation in cancer     111184326 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     111184326 (BCL2L1)    05225 Hepatocellular carcinoma     111184326 (BCL2L1)    05220 Chronic myeloid leukemia     111184326 (BCL2L1)    05222 Small cell lung cancer     111184326 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     111184326 (BCL2L1)    05014 Amyotrophic lateral sclerosis     111184326 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     111184326 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     111184326 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     111184326 (BCL2L1)    05162 Measles     111184326 (BCL2L1)    05168 Herpes simplex virus 1 infection     111184326 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111184326 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     111184326 (BCL2L1)    01524 Platinum drug resistance     111184326 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dle01009]     111184326 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111184326 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dle02000]     111184326 (BCL2L1) Protein phosphatases and associated proteins [BR:dle01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      111184326 (BCL2L1) Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     111184326 (BCL2L1) Transporters [BR:dle02000]  Other transporters   Pores ion channels [TC:1]    111184326 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  111184326 NCBI-ProteinID:  XP_022448453 UniProt:  A0A2Y9PZ68 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaatcgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagcgatgtggacgagaacagaactgaggccccagaaggg actgaatcagacatggaaacccccagtgccatcaatggcaacccgtcctggcacctggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacggcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctatgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system