KEGG   Delphinapterus leucas (beluga whale): 111184326
Entry
111184326         CDS       T05885                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01524  Platinum drug resistance
dle04014  Ras signaling pathway
dle04064  NF-kappa B signaling pathway
dle04115  p53 signaling pathway
dle04137  Mitophagy - animal
dle04140  Autophagy - animal
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04621  NOD-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05145  Toxoplasmosis
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05168  Herpes simplex virus 1 infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05212  Pancreatic cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111184326 (BCL2L1)
   04630 JAK-STAT signaling pathway
    111184326 (BCL2L1)
   04064 NF-kappa B signaling pathway
    111184326 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    111184326 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111184326 (BCL2L1)
   04137 Mitophagy - animal
    111184326 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    111184326 (BCL2L1)
   04215 Apoptosis - multiple species
    111184326 (BCL2L1)
   04115 p53 signaling pathway
    111184326 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111184326 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184326 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    111184326 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111184326 (BCL2L1)
   05225 Hepatocellular carcinoma
    111184326 (BCL2L1)
   05220 Chronic myeloid leukemia
    111184326 (BCL2L1)
   05222 Small cell lung cancer
    111184326 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111184326 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    111184326 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    111184326 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111184326 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    111184326 (BCL2L1)
   05162 Measles
    111184326 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    111184326 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111184326 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111184326 (BCL2L1)
   01524 Platinum drug resistance
    111184326 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111184326 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111184326 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dle02000]
    111184326 (BCL2L1)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111184326 (BCL2L1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111184326 (BCL2L1)
Transporters [BR:dle02000]
 Other transporters
  Pores ion channels [TC:1]
   111184326 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 111184326
NCBI-ProteinID: XP_022448453
UniProt: A0A2Y9PZ68
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaatcgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagcgatgtggacgagaacagaactgaggccccagaaggg
actgaatcagacatggaaacccccagtgccatcaatggcaacccgtcctggcacctggca
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg
taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacggcatat
cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacactttcgtggaactctatgggaacaatgcagca
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system