KEGG   Delphinapterus leucas (beluga whale): 111184404
Entry
111184404         CDS       T05885                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral-signaling protein isoform X1
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111184404 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    111184404 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    111184404 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    111184404 (MAVS)
   05160 Hepatitis C
    111184404 (MAVS)
   05171 Coronavirus disease - COVID-19
    111184404 (MAVS)
   05164 Influenza A
    111184404 (MAVS)
   05162 Measles
    111184404 (MAVS)
   05168 Herpes simplex virus 1 infection
    111184404 (MAVS)
   05169 Epstein-Barr virus infection
    111184404 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 111184404
NCBI-ProteinID: XP_022448622
UniProt: A0A2Y9PZ49
LinkDB
Position
Unknown
AA seq 581 aa
MIKKKSKNSKELKKKERIAFCPTPLPTLLPCVVCFLPVFFPLSQSIHPSWARALCHFRTQ
TAMTFAEDKTYQYIRNHHGNFCNIHVLEILPYLSCLTISDQGCVFQDRLRASYERWGNQG
TLWDLFNSLRRRNGWVPSFIGALRACELSSLADEVDRVYQSNLLRNPNNPPSPLERPSVP
AGVPGPSTPAVTPSIPCNGYREDEPSYPMPVQDTQPPESLGESSKKAPQPPSSGAVLKRL
GGPLQPSSDTVALSPLTCSGHQEQDTELGTTHTAGVVSSFTSSYGPVSPTVSFQPLVRST
PRASRLPGPPVSAPSIGTSSSSTGLASAGGAGDQAEGTICSSGAGVPTNSAFGSTVPSKL
STSLKPPGAMPTNVLTSLAPSKLPINSLHSGMVPPKVPTGLVPGHRKHMCTAPRKLPANT
GPTIRNSNRLVEETPASPAPTGTATGGTSPWPDSSSDCWGSELELSKPGRLVSRMDSQPF
SGCSADLAISHSNSLGVGPDNAPEENEYKSEDTIRIHGGPSTPILGDSPGTHTTPEFREE
EELEELLVVRNLPWAPWLGVAVAGVLLAALLATLYRRRPLQ
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgattaaaaaaaagagcaaaaattccaaagagttgaaaaagaaagagagaattgccttt
tgtccaactccactcccaactctgttgccatgtgtggtctgttttcttccagtctttttt
cctctctctcagtccatccacccttcatgggccagagccctctgccacttcagaacccag
acagcgatgacgtttgctgaggacaagacttatcagtatatccgcaaccatcatggcaat
ttttgcaatattcatgttctggagattctgccttacctatcctgcctcacaataagtgac
cagggctgtgtctttcaggaccgactgcgggcctcctatgagcgctgggggaaccagggc
actctctgggacctcttcaacagccttcggcggcggaacggctgggtgccttccttcatt
ggggcactgagggcctgtgagctgtccagtctcgctgatgaagtggaccgagtctaccag
agcaacctgctacggaatccgaacaaccccccatccccactggagcggccatcagttcct
gctggggttccagggccatccacacctgctgtgacccccagcatcccctgcaatggctac
agagaggacgagccaagttaccctatgcctgtccaggacacccagccaccagagtccctg
ggagagagttcgaagaaagccccacagccacccagctctggggctgtcctcaagaggctg
ggtggccccctgcagccctcatctgacacggtggccctcagccctctgacctgcagtgga
catcaggagcaagacacagaactgggcactacccacacagcaggcgtggtctccagtttc
acatcatcctatgggcctgtgtctccgactgtctccttccagcccttggtccgttctacc
cccagggcaagccgcttgcctggacccccagtgtcagctccatctattggcacctcctcc
tcctccactggcttggcctctgcaggaggtgctggtgaccaggctgaaggtaccatctgc
tccagcggggcaggggtgcccaccaactcagcatttggcagcacagtgccttccaagttg
tccaccagcttgaagccccctggtgcaatgcccactaatgtgctcaccagtctagcacca
tccaaattgcccatcaactcattgcattctggcatggtgccacccaaagtgcctactggc
ttggtgcctggccacaggaaacatatgtgcacggcgcccagaaagctgcctgccaacaca
gggcccaccatcaggaacagcaacagacttgtggaggagactccagcatctccagcaccc
acaggtactgccactggaggcacctcgccatggccagatagcagctctgactgctggggc
tcagagctggagctgagcaagcctggcaggctggtatccagaatggacagccaaccgttc
tcgggctgctccgcagacctcgccatcagccacagtaactccctgggcgtggggcctgac
aacgctccggaggaaaacgagtacaagtcggaggacaccattaggatccacgggggcccc
agtacccccatcctgggggacagccctgggacacacaccaccccagaattccgggaggag
gaagagttggaggagttgctggtggtcaggaacttgccctgggctccgtggcttggggtg
gccgtggctggggtgctcctagctgcgctcctggccacactgtaccggcggcgcccacta
cagtga

DBGET integrated database retrieval system