KEGG   Delphinapterus leucas (beluga whale): 111184533
Entry
111184533         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111184533
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 111184533
NCBI-ProteinID: XP_030617364
LinkDB
Position
Unknown
AA seq 127 aa
MRCLASLALALLALKAALRLAPALPLPGVCPELSSSSEDSCTISCVNDENCPQDTRCCTR
SPCSXSCVVPLIVPVPKAGCCPRVQALLAPKLCLERNECSRDDQCMENQKCCFSSCAMRC
VVPATGP
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcgttgtcttgccagcctggccctggccctgctcgccctgaaggctgccctgaggctg
gccccggccctccccttgccaggcgtgtgcccagagctcagctcctcctccgaggattcc
tgcacaatctcctgtgtcaacgatgagaactgtccccaagacaccaggtgctgcaccagg
agcccctgcagctgatcctgcgtggtccccctcatagtacctgttccaaaggctggctgc
tgtccccgggtgcaggccctgctggccccaaagctctgcttagagagaaacgagtgctcc
agggatgaccaatgtatggagaaccagaagtgctgcttcagctcatgtgccatgaggtgt
gtggtccccgccacaggtccctga

DBGET integrated database retrieval system