KEGG   Delphinapterus leucas (beluga whale): 111184548
Entry
111184548         CDS       T05885                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04072  Phospholipase D signaling pathway
dle04144  Endocytosis
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04520  Adherens junction
dle04540  Gap junction
dle04630  JAK-STAT signaling pathway
dle04810  Regulation of actin cytoskeleton
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle05160  Hepatitis C
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111184548 (EGFR)
   04012 ErbB signaling pathway
    111184548 (EGFR)
   04014 Ras signaling pathway
    111184548 (EGFR)
   04015 Rap1 signaling pathway
    111184548 (EGFR)
   04630 JAK-STAT signaling pathway
    111184548 (EGFR)
   04066 HIF-1 signaling pathway
    111184548 (EGFR)
   04068 FoxO signaling pathway
    111184548 (EGFR)
   04020 Calcium signaling pathway
    111184548 (EGFR)
   04072 Phospholipase D signaling pathway
    111184548 (EGFR)
   04151 PI3K-Akt signaling pathway
    111184548 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111184548 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111184548 (EGFR)
   04520 Adherens junction
    111184548 (EGFR)
   04540 Gap junction
    111184548 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111184548 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111184548 (EGFR)
   04915 Estrogen signaling pathway
    111184548 (EGFR)
   04921 Oxytocin signaling pathway
    111184548 (EGFR)
   04926 Relaxin signaling pathway
    111184548 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    111184548 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184548 (EGFR)
   05206 MicroRNAs in cancer
    111184548 (EGFR)
   05205 Proteoglycans in cancer
    111184548 (EGFR)
   05230 Central carbon metabolism in cancer
    111184548 (EGFR)
   05231 Choline metabolism in cancer
    111184548 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111184548 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111184548 (EGFR)
   05212 Pancreatic cancer
    111184548 (EGFR)
   05225 Hepatocellular carcinoma
    111184548 (EGFR)
   05226 Gastric cancer
    111184548 (EGFR)
   05214 Glioma
    111184548 (EGFR)
   05218 Melanoma
    111184548 (EGFR)
   05219 Bladder cancer
    111184548 (EGFR)
   05215 Prostate cancer
    111184548 (EGFR)
   05213 Endometrial cancer
    111184548 (EGFR)
   05224 Breast cancer
    111184548 (EGFR)
   05223 Non-small cell lung cancer
    111184548 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111184548 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111184548 (EGFR)
   05171 Coronavirus disease - COVID-19
    111184548 (EGFR)
   05163 Human cytomegalovirus infection
    111184548 (EGFR)
   05165 Human papillomavirus infection
    111184548 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111184548 (EGFR)
   01522 Endocrine resistance
    111184548 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111184548 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111184548 (EGFR)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111184548 (EGFR)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   111184548 (EGFR)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111184548 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   111184548 (EGFR)
  Exosomal proteins of bladder cancer cells
   111184548 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Borrelia_P83 Kdo
Other DBs
NCBI-GeneID: 111184548
NCBI-ProteinID: XP_022448878
UniProt: A0A2Y9Q0F2
LinkDB
Position
Unknown
AA seq 1209 aa
MRRSEAGRAVLLALLAAHFQASPALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQSSYNLSFLKTIQEVAGYVLIALNTVEKIPLEKLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPMRNLQEILQGAVRFSNNPILCNMDTVQWRDIVNTDFLSNMSIEF
QSQLSRCPKCDPVCLNGSCWGAGKENCQKLTKVICAQQCSGRCRGRSPSDCCHSQCAAGC
TGPRESDCLVCRRFRDGATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVRKCPRNYV
VTDHGSCVRACSSESQEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFKGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPANRTGLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRRLCYADTINWKKL
FGTSSQKTKITNNRSEKECKAMGHVCDPLCSSEGCWGPKPKDCMSCRNFSRGKECVEKCN
VLKGEPREFIENSECVQCHPECLPQAMNVTCTGHGPGSCVKCAHNIDGPHCVKTCPAGVT
GENSTLIWKFADASHVCHLCHASCAYGCAGPGSEGCAVSGPRIPSIATGMVGALLLALVL
ALGVGLFLRRRRIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETELKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHIKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRTLMDEEDMQDVVDADEYLIPQ
QGFFHSPASSRTPLLSSLSSTSNTPTVACGDRNGQSYPLQEDSFLQRYSSDPTGTLNEDS
IDDAFLPAPEYVNQSIPKRPAGSVQNPVYRNQPLNPAPGRDPHYQNSHSNAVDSPEYLNT
TLPACTNGVLDGPALWAQKGGHQISLDNPDYQQAFFPKEAKSNGIFKGSAAENAEYLRVA
PAGSDLTGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgacgctccgaagcgggccgcgccgtgctcctggcgctgctggccgcgcacttccag
gcgagtccggcgctggaggagaagaaagtttgccaagggacaagtaacaagctcacccag
ttgggcacttttgaagaccactttctgagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctacatgcaaagtagttacaacctttctttcctaaag
accatccaggaggttgctggctatgtactcattgccctcaacacagtggagaagattcct
ttggaaaagctgcagatcatcagaggaaatgtgctctatgaaaacacccatgccttagcg
gtcttatccaactacggtgcaaataaaacgggactgagggagttgcccatgagaaactta
caggagatcctgcaaggcgccgtgcgattcagcaacaaccctatcctctgcaacatggac
accgtccagtggagggacatcgtcaacaccgactttctaagcaatatgtcgattgaattt
cagagccagctgagcagatgcccaaagtgtgatccagtctgtcttaatggaagctgctgg
ggtgcagggaaggagaactgccagaaactgaccaaagtcatctgtgcccagcagtgttcc
gggcgctgccgcggcaggtcccccagcgactgctgccacagccagtgtgccgccggctgc
acggggccacgggagagtgactgcctggtctgccgcaggttccgggacggagccacgtgc
aaggacacatgcccgccactcatgctgtacgaccccaccacctacgagatgaaagtcaac
ccgctggggaagtacagcttcggcgccacctgtgtcaggaagtgcccccgtaactacgtg
gtgacggaccacggctcgtgcgtccgcgcctgcagctctgagagccaggaggtggaggag
gacggcgtccgcaagtgtaaaaagtgcgacggaccttgtggcaaagtttgtaacggaata
ggaattggtgagtttaaagacacactttccataaatgctacaaatattaaacacttcaga
aattgcacctcgatcagtggagaccttcatatcctgccagtagcatttaagggtgattcc
ttcacacgtactccacctctggacccaaaggaactggacattctaaaaaccgtaaaggaa
ataacagggtttttgctgattcaggcctggcctgcaaacaggactggcctccatgctttt
gagaacctggaaatcatacgtggcaggacgaagcaacatggtcagttttctctggcggtt
gttggcctggatataacgtccttgggattacgctccctcaaggagataagtgatggagat
gtgatcatttcaggaaaccgaaggttgtgctacgcagatacaataaactggaaaaaactc
tttgggacctcaagtcagaaaaccaaaattacaaacaacaggagtgaaaaagagtgcaag
gccatgggccacgtctgtgacccgctgtgctcgtcagagggctgctggggcccaaaaccc
aaagactgcatgtcttgccgaaacttcagccgtggcaaggagtgtgtggagaagtgcaac
gttctaaagggagagcccagggagttcattgaaaactccgagtgcgtgcagtgccatccg
gaatgcctgcctcaggccatgaacgtgacctgcacgggacacggaccaggcagctgtgta
aagtgtgcccacaacatcgacggccctcactgcgtcaagacctgccctgctggagtcaca
ggagaaaacagcaccctgatctggaagtttgcagatgccagtcacgtgtgtcacctgtgc
cacgccagctgcgcctacggctgtgctgggccaggttctgaaggctgtgcagtgagtggg
cccaggattccgtccatcgccaccgggatggtgggcgccctgctgctggccctggtgctg
gccctgggggtcggcctctttctgcgcaggcgtcgcatcgtccgcaagcgcacgctgcgc
cggctgctgcaggagcgcgagcttgtcgagcctctgacgcccagcggagaagctcccaac
caagctctcttgaggatcttaaaggagacggaattaaaaaaggtcaaggtgctgggctcc
ggagcattcggcacggtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
cctgtggctatcaaggaattaagagaagccacatctccaaaagccaacaaggaaattctt
gatgaagcctacgtgatggccagtgtggacaatccgcacgtgtgccgcctcctgggcatc
tgcctgacgtccacggtgcagctcatcacgcagctcatgcccttcggctgcctgctggac
tatgtccgcgagcacaaggacaacatcggctcccagcacctgctcaactggtgcgtgcag
atcgcaaagggcatgaactacctggaagaccggcgcctggtgcaccgagacctggcggcc
aggaatgtgctggtgaagacaccgcagcacatcaagatcacggatttcggcctggccaaa
ctgctcggcgccgaggagaaagaataccacgcggaggggggcaaggtgcctatcaagtgg
atggctttggaatcaattttacaccgaatttatacccaccagagtgacgtctggagctac
ggagtcaccgtttgggagttgatgacctttgggtccaagccttacgacgggatccccgcg
agtgagatctcaaccgtcctggagaagggagaacgcctgcctcagccgcccatctgcacc
atcgacgtctacatgatcatggtcaagtgctggatgattgatgcagacagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtc
atccagggggacgagagaatgcatttgccaagccccacggactccaacttctaccgcacc
ctgatggacgaagaggacatgcaagatgttgtggatgcggacgagtacctcatcccccag
cagggcttcttccacagccccgccagctcccggacgcccctcctcagttctctgagctcc
accagcaacacgcccactgtggcttgcggtgatagaaacgggcagagctatcccctccag
gaagatagcttcttgcagcggtacagctcagaccccactggcaccttgaacgaggacagc
atagatgacgccttccttccagcgcccgaatacgtaaaccagtctattcccaaaaggccc
gcgggctctgtccagaaccccgtctatcgcaatcagcctctaaacccggctccaggcaga
gaccctcactaccagaattcccacagcaatgccgtggacagccctgagtatctcaacacc
acccttcccgcctgcaccaacggtgtgctcgacggccctgccctctgggcacagaagggc
ggtcaccaaattagcctggacaaccctgactaccagcaggccttctttcccaaggaagcc
aagtcaaatggcatctttaagggttctgccgctgaaaatgcagaatacctaagggtagca
ccagcgggcagcgaccttaccggggcctga

DBGET integrated database retrieval system