KEGG   Delphinapterus leucas (beluga whale): 111184673
Entry
111184673         CDS       T05885                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00590  Arachidonic acid metabolism
dle01100  Metabolic pathways
dle04064  NF-kappa B signaling pathway
dle04370  VEGF signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04668  TNF signaling pathway
dle04723  Retrograde endocannabinoid signaling
dle04726  Serotonergic synapse
dle04913  Ovarian steroidogenesis
dle04921  Oxytocin signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05140  Leishmaniasis
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05204  Chemical carcinogenesis
dle05206  MicroRNAs in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111184673 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111184673 (PTGS2)
   04064 NF-kappa B signaling pathway
    111184673 (PTGS2)
   04668 TNF signaling pathway
    111184673 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111184673 (PTGS2)
   04657 IL-17 signaling pathway
    111184673 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    111184673 (PTGS2)
   04913 Ovarian steroidogenesis
    111184673 (PTGS2)
   04921 Oxytocin signaling pathway
    111184673 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    111184673 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    111184673 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184673 (PTGS2)
   05206 MicroRNAs in cancer
    111184673 (PTGS2)
   05204 Chemical carcinogenesis
    111184673 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111184673 (PTGS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111184673 (PTGS2)
   05022 Pathways of neurodegeneration - multiple diseases
    111184673 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111184673 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111184673 (PTGS2)
   05165 Human papillomavirus infection
    111184673 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111184673 (PTGS2)
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     111184673 (PTGS2)
SSDB
Motif
Pfam: An_peroxidase EGF
Other DBs
NCBI-GeneID: 111184673
NCBI-ProteinID: XP_022449092
UniProt: A0A2Y9Q0P2
LinkDB
Position
Unknown
AA seq 604 aa
MLARALLLCAALALCGAANPCCSSPCQNRGVCMSIGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLQNMIMRYVLISRSHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRVLPPVPDDCPTPMGVKGRKELPDSKEVVEKVLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTTGQSHGVDLNHVYGESLERQHKLRLFKDGKMKY
QIIGGEMYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKHEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDGQDYKYQQFVYNNSLLLEHGLTQFVESFTRQIAGRV
AGGRNLPVAVEKVSKASIDHSREMKYQSFNEYRKRFLLKPYKSFEELTGEKEMAAELEAL
YGDVDAMELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIIKTASIQSLICNNVKGCPFTSFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgcttgcccgcgcgctgctgctctgcgccgccctggcgctctgtggtgcagcaaatcct
tgctgttccagtccatgccagaatagaggtgtatgtatgagcataggatttgaccagtat
aaatgtgactgtacccgaacaggattctatggtgaaaactgtaccacacctgaatttctg
acaagaataaaattattcctgaaacccactccaaacacagtgcactacatacttacgcac
ttcaagggagtctggaacattgtcaataacattcccttcctgcagaacatgattatgaga
tatgtgttgatatcgagatcacatctgattgacagcccgccaacttataatgtgcactac
ggctataaaagctgggaagccttttctaacctgtcctattacaccagagttcttcctcct
gtgcctgatgactgcccaacacccatgggtgtcaaagggaggaaagagcttcctgattca
aaagaagttgtggaaaaagtacttctaagaagaaagttcatccctgatccccagggcaca
aatatgatgtttgcgttctttgcccagcacttcacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccacgggacagagccatggggtggacttaaatcatgtttat
ggtgaatctttggagagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattggtggtgaaatgtatcctcccacagtcaaagatactcaggtcgagatgatc
tacccccctcatgttcctgaacacctgcggtttgctgtggggcaggaagtctttggtctg
gtgcctggtctgatgatgtatgccacaatttggctgcgggaacacaacagagtgtgtgat
gttcttaaacatgagcatccagaatgggacgatgagcggttgttccagacaagtaggcta
atactgataggagaaactattaagattgtgattgaagactatgtacagcacctgagtggc
tatcacttcaaactgaagtttgacccagagctgctttttaaccaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
tttcagattgatggccaggactacaagtatcagcaatttgtctataacaactccctctta
ctggaacacggcctcactcagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatcttccagttgcagtagagaaagtatcaaaggcttcaattgaccac
agcagagagatgaaataccagtcttttaatgagtaccgcaaacgctttctgctgaagcct
tataaatcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcgctc
tatggtgacgttgatgccatggagctgtatcctgctcttctggtagaaaagcctcgacca
gacgccatctttggggagaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatcctatatgttctcctgagtactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaagactgcctcaattcagtctctcatctgcaataacgtgaaaggc
tgtccttttacctcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagctcttcccactctggactagatgatatcaaccccacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system