KEGG   Delphinapterus leucas (beluga whale): 111184749
Entry
111184749         CDS       T05885                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04218  Cellular senescence
dle04370  VEGF signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04722  Neurotrophin signaling pathway
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111184749 (MAPKAPK2)
   04370 VEGF signaling pathway
    111184749 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111184749 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111184749 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111184749 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111184749 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111184749 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111184749 (MAPKAPK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111184749 (MAPKAPK2)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   111184749 (MAPKAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like Choline_kinase
Other DBs
NCBI-GeneID: 111184749
NCBI-ProteinID: XP_022449291
UniProt: A0A2Y9PVR7
LinkDB
Position
Unknown
AA seq 413 aa
MLSNSGAVPQPAAAAATAPCCPTPAMFPNPPPPPQPPAPAQPHPPAQPPPQPPQQFPQFH
VKSSLQIKKNAIIDDYKVTTQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVEL
HWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIM
KSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTP
YYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKSRIRMGQYEFP
NPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKE
RWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgctgtccaactccggtgctgttccccagcccgccgccgccgccgccaccgcaccatgc
tgtccaacgccggcgatgttccccaacccgccgccgccgccgcagccccccgccccggcc
caacctcaccccccggcccagccgccgccgcagcccccgcagcagttcccccagttccac
gtcaagtcgagcctgcagatcaagaagaacgccatcatcgacgactacaaggtcaccacc
caggtcctgggactgggcatcaacgggaaagttttgcagatcttcaacaagaggacccag
gagaaattcgccctaaaaatgctgcaggactgccccaaggcccgccgggaggtggagctg
cactggcgggcctcccagtgcccacacattgtgcggatcgtggacgtctatgagaacctg
tacgcggggaggaagtgcttgctgattgtcatggagtgtttggatggtggagaactcttc
agccgaatccaggatcgaggagaccaggcattcacagaaagagaggcatcagagatcatg
aagagcatcggcgaggcgatccagtacttacactcaatcaatatcgcgcatcgggatgtc
aagcctgagaatctcttatacacctccaaaaggcccaacgccattctcaaactcactgat
tttggctttgccaaggaaaccaccagccacaactctctgaccactccttgttacacgcca
tactatgtggctccagaagtgctgggcccagagaagtatgacaagtcctgtgacatgtgg
tccttgggtgtcatcatgtacatcctgctgtgtgggtatccccccttctattccaaccat
ggccttgccatctctccgggcatgaagagtcgcatccgaatgggccagtatgaattcccc
aacccagaatggtcagaagtatcagaggaagtgaagatgctcatccggaacctgctgaag
acagagcccacccagaggatgaccatcaccgagttcatgaaccacccctggatcatgcaa
tcaacaaaggtccctcagaccccactgcacaccagccgggtcctgaaggaggacaaggag
aggtgggaggacgtcaaggaggagatgaccagtgccttggccacgatgcgggtcgactat
gagcagatcaagataaaaaagattgaagacgcatccaaccctctgcttctgaagaggcgg
aagaaagctcgggccctggaggctgcggccctcgctcactga

DBGET integrated database retrieval system