KEGG   Delphinapterus leucas (beluga whale): 111184753
Entry
111184753         CDS       T05885                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit epsilon isoform X1
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111184753 (IKBKE)
   04621 NOD-like receptor signaling pathway
    111184753 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    111184753 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    111184753 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    111184753 (IKBKE)
   04657 IL-17 signaling pathway
    111184753 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    111184753 (IKBKE)
   05160 Hepatitis C
    111184753 (IKBKE)
   05171 Coronavirus disease - COVID-19
    111184753 (IKBKE)
   05164 Influenza A
    111184753 (IKBKE)
   05162 Measles
    111184753 (IKBKE)
   05168 Herpes simplex virus 1 infection
    111184753 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111184753 (IKBKE)
   05169 Epstein-Barr virus infection
    111184753 (IKBKE)
   05165 Human papillomavirus infection
    111184753 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111184753 (IKBKE)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     111184753 (IKBKE)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111184753 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like zf-RING_9
Other DBs
NCBI-GeneID: 111184753
NCBI-ProteinID: XP_022449303
UniProt: A0A2Y9Q1P3
LinkDB
Position
Unknown
AA seq 807 aa
MTTSPESSGGVTQSHKPACPTAEMGRWPASWEQEMQSTVNYLWHTDDLLGQGATASVYKA
RNKKSGELVAVKVFNTASYLRPREVQVREFEVLRKLNHQNIIKLFAVEETGGSRQKVLVM
EYCSSGSLLSALESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVG
EEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVAVDLWS
IGVTLYHAATGSLPFVPFGGPRRNKEIMYRITTEKPTGAIAGTQRLENGPLEWSYTLPIT
CQLSMGLQSQLVPILANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLPQAVVHHVYI
HAHNTIAIFLEAVYKQTNVAPQHQEYLFEGHLCVLEPSLSAQHIAHTTASSPLTLFSMVC
ETPKGLAFRDRCRRQIWVLILHTPLKCHVTRAGGLPNLLRSVQRSGKGTPVETGRCGFNV
VSTVRAALDIPKFFPKVDLQADYNTAKGVLGAGYQALRLAQALLTGQELMLRGLHWFVES
LQATCRRTLEVTRMALLFLSSSLGTERFSNVAGVPEIQELKRAAELRSKLRTLAEVLSRC
SHNITETKMTLSNLSSELMKNRDQVHADRSIQQIQCCLDKMYLIYKQFKKSRMRPGLGYN
EEQIHKLDKVNFSHLAKRLLQVFQEERVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVA
ACNTEAQGAQESLSKILDWLSHQLLQDRTKEAQASPPTTAPYPSPALKDLVLHMQELCKE
MKVLASDLQDNNRVIEGLSRVPSAPDI
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgacaacaagccctgaaagctcggggggcgtcacgcagtcccacaagcctgcatgcccc
acagccgagatgggaaggtggccggccagctgggagcaagagatgcagagtaccgtcaat
tacctgtggcacacggatgacctgctgggtcagggggccactgccagtgtgtacaaggcc
cgaaacaagaaatccggggagctggttgctgtgaaggtcttcaacacggccagctacctg
cgaccccgcgaggtgcaggtgagggagtttgaggtcctgcggaagctgaaccatcagaac
atcatcaagctctttgcggtggaggagacggggggcagccggcagaaggtgctggtgatg
gagtactgctccagcgggagcctgctgagtgcgctggagagccctgagaacgcctttggg
ctgcccgaggacgagttcctggtggtgctgcgctgtgtggtggccggcatgaaccacctg
cgggagaacggcatcgtccaccgagacatcaagcccgggaacatcatgcgcctggtcggg
gaggaggggcagagcatctacaagctgacggacttcggggcagcccgggagctggatgac
gacgagaagttcgtctcggtctacggcaccgaggagtacctgcaccctgacatgtatgag
cgggcggtgcttcgcaagccccaacagaaagcttttggggtggccgtggatctctggagc
attggggtgaccctgtaccatgcggccactggcagcctgcccttcgtcccctttggaggg
ccccgacgcaacaaggagatcatgtaccggatcaccacagagaagccaaccggggccatt
gcaggcactcagaggctggagaacgggcccctggagtggagctacaccctccccatcacc
tgtcagctgtccatggggctgcagagccagctggtgcccatcctggccaacatcctggag
gtggagcaggccaagtgctggggcttcgaccagttctttgcggagaccagtgacatcctg
cagcgagttgtcgtccacgtcttctccttgccgcaggccgtcgtgcaccacgtctacatc
cacgcgcacaacacgatagccatctttctagaggccgtgtacaagcagaccaacgtggcc
ccccagcaccaggagtacctctttgagggtcacctctgtgtcctcgagcccagcctctca
gcacagcacatcgcccacacgacagcaagcagccccctgaccctgttcagcatggtctgc
gagacccccaaggggctggccttcagggaccggtgtagaaggcagatctgggttctaatt
ctgcatacgcctctgaaatgccatgtgactcgggctggtggcctgcccaacctgcttcgc
agcgtccaaagatctgggaaaggaactccagtggaaacagggagatgtggattcaatgtg
gtctccacagtccgtgctgctctggacatccccaagtttttccccaaagtggacctgcag
gcagattacaacacggccaagggtgtgttgggtgccggctaccaggccctgcggctggca
caggccttgctgacaggacaggagctgatgcttcgggggctgcactggttcgtggagtca
ctccaggccacgtgcaggcggacgctggaggtcacgaggatggccctcctcttcctcagc
agcagcctcggcactgagaggttcagcaacgtggctggggtgcctgagatccaggaactg
aagagagccgcagagctgaggtccaagctgcggaccttggctgaggtcctctccagatgt
tcccataatatcacagagaccaagatgaccctaagcaacctgagctctgagctgatgaag
aaccgggatcaggtacatgcggacagaagcatccagcagattcagtgctgtttggacaag
atgtatctcatttacaaacagttcaagaaatccaggatgaggccagggcttggctacaac
gaggagcagattcacaagctggataaggtgaattttagtcatttagccaaaaggctcctg
caggtgttccaggaggagcgtgtgcagaagtaccaggcatccctggtcacgcatggcaag
agaatgagggtggtgcatgagaccaggaaccacctgcgcctggtgggctgctccgtggcc
gcctgtaacacagaagcccagggagcccaggagagcctcagcaagatccttgactggcta
tctcaccagctcctgcaggacagaacaaaggaggctcaggcctcaccacccactacagct
ccttatcctagccctgcactaaaggacctggttctccacatgcaagagctctgcaaggag
atgaaggtgctggcgtctgacctccaggacaacaaccgcgtcatcgaagggttaagtagg
gtcccatcggctcctgacatctga

DBGET integrated database retrieval system