KEGG   Delphinapterus leucas (beluga whale): 111184764
Entry
111184764         CDS       T05885                                 

Gene name
SLC45A3
Definition
(RefSeq) solute carrier family 45 member 3
  KO
K15379  solute carrier family 45, member 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05202  Transcriptional misregulation in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111184764 (SLC45A3)
   05206 MicroRNAs in cancer
    111184764 (SLC45A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dle02000]
    111184764 (SLC45A3)
Transporters [BR:dle02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   111184764 (SLC45A3)
SSDB
Motif
Pfam: MFS_1 MFS_2 MFS_1_like
Other DBs
NCBI-GeneID: 111184764
NCBI-ProteinID: XP_022449336
UniProt: A0A2Y9PR65
LinkDB
Position
Unknown
AA seq 553 aa
MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
PVLGLVSVPLLGSASDHWRGRYGRRRPFIWALSLGVLLSLFLIPRAGWLAGLLCPDTRPL
ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAFSVYAFMISLGGCLGYLLPA
IDWDASALAPYLGTQEECLFGLLALIFLTCVAATLFVAEEAALGPAEPVEGLSVPSVPPH
CCPCHARLAFWNLRALFPRLHQLCCRMPHTLRRLFVAELCSWMAFMTFTLFYTDFVGEGL
YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLLFSLVMDRLVQRFGTRAVYLASVV
AFPVAAGATCLSRSVVVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDDGG
GASEDSLMTSFSPGPKAGSPFPNGHLGAGGSGLLPPPPALCGASACDVSMRAVVGEPPEA
RVVPGRGICLDLAVLDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFVTQ
VVFDKSDLAKYSV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggtccagaggctgtgggtgagccgcctgctgcggcatcggaaagcccagctcctgctg
gtcaacctgctgaccttcggcttggaggtgtgcctggctgcgggtatcacctacgtgcca
cccctgctgttggaagtgggggtagaggagaagttcatgaccatggtgctgggcatcggt
ccagtgctgggtctggtctcggtcccactcctaggctcagccagcgaccactggcgtggg
cgctatggtcgccggaggcccttcatctgggccctgtccctgggtgtcctgctgagcctc
ttcctcatcccgagggccggctggctggcggggctgctgtgcccggacaccaggcccctg
gagctggcactgctgatcctgggcgtggggctgctggacttctgtggccaggtgtgcttc
actccgctggaggccctcctctctgacctcttccgggacccagaccactgtcgccaggcg
ttctccgtctacgccttcatgatcagcctggggggctgcctgggctaccttctgcctgcc
atcgactgggatgccagtgccctggccccctacctgggcacccaggaagagtgcctcttc
ggcctgcttgctctcatcttcctcacttgcgtggcagccacactgtttgtggctgaggag
gcggcgctgggcccagccgagcccgtggaagggctgtcggtcccctctgtaccaccccac
tgctgcccgtgccacgcccgcctggctttctggaacctgcgcgccctctttccccggctg
caccagctctgttgccgcatgcctcacaccctacgccgactcttcgtggccgagctgtgc
agttggatggcattcatgaccttcacactgttttacacagactttgtgggcgaggggcta
taccagggtgtgcccagggctgagccaggcaccgaggcccggagacactatgatgaaggg
gtccggatgggcagcctggggctgttcctgcagtgtgctatctccctgctcttctctctg
gtcatggaccggctggtgcagcgattcggcaccagggcagtctatctggccagcgtggtg
gctttccccgtggctgccggcgccacgtgcctgtcccgcagcgtggtggtggtgaccgct
tcggctgccctcactgggttcaccttctctgccctgcagatcctgccgtacacgctagca
tccctctaccaccgggagaagcaggttttcctgcccaaataccgcggagatgatggaggt
ggtgccagtgaggacagcctgatgaccagcttctcaccgggccctaaggccggatctccc
ttccccaatggacacctgggtgctggaggcagcggcctgctccctcctccaccagcactc
tgcggggcctccgcctgcgatgtctccatgcgtgcagtggtgggcgagccaccggaggcc
agggttgttccgggccggggcatctgcctggaccttgccgtcctggacagtgccttcctg
ctgtcccaggtggccccgtctctctttatgggctccattgttcagctcagccagtctgtc
actgcctatatggtgtcggctgcaggtctgggtctggttgccatttactttgtcacacag
gtggtatttgacaagagcgacttggccaaatactctgtgtag

DBGET integrated database retrieval system