KEGG   Delphinapterus leucas (beluga whale): 111185202
Entry
111185202         CDS       T05885                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle03320  PPAR signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04210  Apoptosis
dle04510  Focal adhesion
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04722  Neurotrophin signaling pathway
dle04910  Insulin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04931  Insulin resistance
dle04960  Aldosterone-regulated sodium reabsorption
dle05145  Toxoplasmosis
dle05205  Proteoglycans in cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05223  Non-small cell lung cancer
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111185202 (PDPK1)
   04071 Sphingolipid signaling pathway
    111185202 (PDPK1)
   04151 PI3K-Akt signaling pathway
    111185202 (PDPK1)
   04152 AMPK signaling pathway
    111185202 (PDPK1)
   04150 mTOR signaling pathway
    111185202 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111185202 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    111185202 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111185202 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111185202 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    111185202 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111185202 (PDPK1)
   03320 PPAR signaling pathway
    111185202 (PDPK1)
   04919 Thyroid hormone signaling pathway
    111185202 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111185202 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111185202 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111185202 (PDPK1)
   05231 Choline metabolism in cancer
    111185202 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    111185202 (PDPK1)
   05213 Endometrial cancer
    111185202 (PDPK1)
   05223 Non-small cell lung cancer
    111185202 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111185202 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111185202 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111185202 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111185202 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111185202 (PDPK1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111185202 (PDPK1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   111185202 (PDPK1)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    111185202 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 111185202
NCBI-ProteinID: XP_022450298
UniProt: A0A2Y9Q4F2
LinkDB
Position
Unknown
AA seq 558 aa
MARTTSQLYDTVPIQSSVVLCSCPSPSMVRTQTESSTAPGVPSCGSRQGPTMDSTTAESR
PSANSLQHATQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESITWENLHHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSAADAGLPQRVGSNIEQYIHD
LDTNSFELDLQFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVWRHRYQSHPDAAVQ
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacaccgttcctattcagtccagcgtggtatta
tgttcctgcccgtccccatcaatggtgaggacccagactgagtccagcacggcccctggc
gttcccagctgtggtagcaggcagggccccaccatggacagcaccacggccgaatcccgg
ccaagcgccaactcgctgcaacacgccacacagccgccaccacagcctcggaagaaacgg
ccagaagactttaaatttgggaaaattcttggtgaaggctctttttcaacagttgtcctg
gcccgagaactggcaacctcaagggaatatgctattaaaattctagagaaacgtcacatt
atcaaagagaacaaagtcccgtatgtaaccagagagagagacgtgatgtcgcggctggat
caccccttctttgttaaactttacttcacatttcaggatgatgaaaagctctattttggc
cttagttatgccaaaaatggagaactacttaaatacattcggaaaattggttcgttcgat
gagacatgcacccgattttacacagctgagatggtgtctgccctagagtacttgcatggc
aagggcatcattcacagggacctgaaaccagaaaatattttgttaaatgaagatatgcac
atccagatcacagattttggaacagcaaaagtattatccccagagagtaaacaagccagg
gccaactcgtttgtaggaacagcccagtatgtttctccagagctgctcacagagaaatcg
gcctgtaaaagttcagacctttgggctcttggatgcataatataccagcttgtggcagga
ctgccaccgttccgagctggaaatgaatatcttatatttcagaagatcattaagttggaa
tatgactttcctgaaaaattctttcctaaggcaagagatcttgtggaaaaacttctggtt
ttagatgccacaaagcgattaggctgtgaagaaatggaagggtatggccctctgaaagct
catccgttctttgagtccatcacgtgggagaacctgcatcaccagacgcctccaaagctc
acagcttacttaccggccatgtcggaagatgatgaggactgctacggcaattacgacaat
ctcctgagccagttcggctgcatgcaggtgtcgtcgtcctcctcctcccactccctgtcc
gccgcggacgcggggctgccccagagggtgggaagcaacatcgagcagtatatccacgac
ctggacactaattcttttgaactggacttacagttttctgaagatgagaagaggttgtta
ttggagaagcaggccagcggaaacccttggcaccagtttgtagaaaataatttaatacta
aaaatgggtccagtagacaagcgcaagggtttatttgcacggcgacgacagttactgctc
acagaagggccacacttatattatgtggatcctgtcaacaaagtcttgaaaggtgaaatt
ccatggtcacaagaactccggccagaggctaagaattttaaaaccttctttgtccacacg
ccgaataggacgtattacctgatggacccgagcgggaatgctcacaaatggtgcaaaaag
atccaggaggtgtggaggcacagataccagagccacccggacgccgccgtgcagtga

DBGET integrated database retrieval system