KEGG   Delphinapterus leucas (beluga whale): 111185272
Entry
111185272         CDS       T05885                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03460  Fanconi anemia pathway
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    111185272 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111185272 (POLK)
   05202 Transcriptional misregulation in cancer
    111185272 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111185272 (POLK)
   05212 Pancreatic cancer
    111185272 (POLK)
   05225 Hepatocellular carcinoma
    111185272 (POLK)
   05226 Gastric cancer
    111185272 (POLK)
   05214 Glioma
    111185272 (POLK)
   05216 Thyroid cancer
    111185272 (POLK)
   05220 Chronic myeloid leukemia
    111185272 (POLK)
   05217 Basal cell carcinoma
    111185272 (POLK)
   05218 Melanoma
    111185272 (POLK)
   05213 Endometrial cancer
    111185272 (POLK)
   05224 Breast cancer
    111185272 (POLK)
   05222 Small cell lung cancer
    111185272 (POLK)
   05223 Non-small cell lung cancer
    111185272 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111185272 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dle03400]
    111185272 (POLK)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     111185272 (POLK)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    111185272 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 111185272
NCBI-ProteinID: XP_022450513
UniProt: A0A2Y9PYH3
LinkDB
Position
Unknown
AA seq 878 aa
MDSTEEKNDSTKEKNDNYKDDLLLRVGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNE
LKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEHSRDLNNTIVHIDMDAFYA
AVEMRDNPELKDKPIAVGSVSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDK
YRAVSREVKEILADYDPNFMAMSLDEAYVNITKHLEERQNWPEDKRKYFIKTGNSLENDK
PGKEVNKLHEQERSISPLLFEDSPPDLQSPGNPFQVNFEELNNLQILQNSIVFGTSAEEV
VKEMRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRK
VSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTQLARDGER
KSMSVERTFSEISKAEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRAST
VSSVVSTAEEIFAIAKELLRTEIDADFPHPLRLRLMGVRLSGFPNEEEKKCQQRSIIGFL
QPGNQALSATRCIPEKTDKDQFLKPLEMSHKKSFFDKKRSERNWSYQDTFKCETVDKQSL
QTSQFFQVLKKRMSENLETLENSDNCHIFTCPVCFREQGSISLEAFNKHVDACLDGPSIS
GNSKMSSRSHASSTEVNEKENVHDSVSVCEKQDCETHQKNTVITSVDSVELAETTGNPSN
TEGVDALSNKHSEEECSSLPSKSFNMEHCPQNCCTVPLENEDVASLGRKEPLQPYLYEVI
SDQVLVCPVCNLEQKTSDLTLFNVHVDVCLNKGMIQELRKDKVNPVNQPKESATSTDNSG
KVQKIGTKANRPRLMTKYSASKKTKPNSPRHTLDIFFK
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggatagcacagaggagaagaatgacagcacaaaggagaagaatgacaattacaaagat
gatcttctgctaagggtgggacttaatgataataaagccggaatggaaggattagataaa
gagaaaattaacaaaattataatggaagccacaaaggggtccagattttatggaaatgag
ctcaagaaagaaaagcaagtcaaccaacgaattgaaaatatgatgcaacaaaaagctcaa
attaccagccagcagctaaggaaagcacaattacaggttgacagatttgcaatggaattg
gagcacagccgggatctgaacaataccatagtacacattgacatggatgctttctatgca
gctgtagaaatgagggacaatccagaactgaaggataaacccattgctgtaggatcagtg
agtatgttgtctacttcgaattaccacgcaaggagatttggtgttcgtgcagccatgcca
ggattcattgcaaaaaggctctgcccacaacttattatagtgcccccaaactttgacaaa
taccgagctgtgagtagagaggttaaggaaatacttgctgattatgatcccaattttatg
gccatgagtcttgatgaagcctacgtgaatataacaaagcatttagaggaaagacaaaat
tggcctgaggacaaaaggaagtatttcatcaaaacagggaactctctagaaaatgataaa
ccaggaaaggaagttaataaactgcatgagcaagaacgatccatctctcctctacttttt
gaagatagtcctcctgatttgcagtccccaggaaatcctttccaagtgaactttgaagaa
ctgaataatcttcaaatactccaaaactcaattgtttttggaacatcagctgaggaagtg
gtaaaggaaatgcgtttcagaatcgagcaaaaaactacactgacagccagtgcaggcatt
gcaccaaatacaatgttagcgaaagtatgcagtgataagaataaaccaaatggacaatac
caaattctccctaatagacaagctgtgatggacttcatcaaggacttacccattagaaag
gtttctgggataggaaaagttacagagaaaatgttgaaggcccttggaattattacttgt
acagaactataccaacagagggcattactttctctccttttctctgaaacatcttggcat
tatttccttcatatttccctgggtctaggttcaacacagctggcaagggatggagagagg
aaaagcatgagtgttgagaggacattcagtgagataagtaaagcagaagaacagtacagc
ttgtgccaagaactttgcagtgaacttgctcaagatctgcagaaagaaggacttaagggt
agaactgttaccattaagctaaagaatgtgaattttgaagtaaaaactcgtgcatctaca
gtttcatctgttgtttctactgcagaagaaatatttgctattgctaaagaattgctaaga
acagaaattgatgctgattttccacatcccttgagattaagacttatgggggtgcgacta
tctggttttcccaatgaagaggagaagaaatgccaacaaaggagcattattggcttctta
cagcctggaaaccaagccctgtcagccaccaggtgtataccagagaaaactgacaaagat
cagtttctaaaacctctagaaatgtctcataagaagagtttctttgataaaaaacgatct
gaaaggaattggagctaccaggacacatttaaatgtgaaactgtagataaacaaagttta
cagacatcgcaattcttccaagttttaaagaagaggatgagtgagaatttagaaacattg
gagaattcagataactgtcatatatttacttgtcctgtttgcttcagggagcaaggaagc
atcagtctggaagcctttaataaacatgtagatgcgtgtcttgatggaccttccatcagt
ggaaactctaaaatgtcctcacgttcacatgcttcctctacagaagtgaatgagaaagaa
aatgtccatgattctgtttctgtctgtgagaagcaggattgtgaaactcatcagaagaat
acagtgatcacatcagtagattctgtagagttggcagagactactggtaatccatctaat
acagaaggtgtagatgcgctaagtaataagcacagtgaagaggaatgttctagtcttcca
agcaaatcgtttaatatggaacactgtcctcagaattgttgcactgtgccactggaaaat
gaagatgttgcgtcattaggaaggaaagagcccctacaaccttatttatatgaagtgatc
agtgaccaagtcctcgtttgtcctgtgtgtaacctagaacaaaagacttcagatcttacc
ctattcaatgtgcatgtagatgtttgcttaaataaaggcatgatccaggaactgagaaag
gataaggttaatccagttaaccaacccaaagaaagcgccacaagtactgataactcaggc
aaagtacagaagattggaacaaaagcaaacaggccaagactgatgacaaagtactcggca
tcaaagaaaacaaaaccaaacagtcccagacacacccttgatatattttttaaatga

DBGET integrated database retrieval system