KEGG   Delphinapterus leucas (beluga whale): 111185755
Entry
111185755         CDS       T05885                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04010  MAPK signaling pathway
dle04071  Sphingolipid signaling pathway
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04137  Mitophagy - animal
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04216  Ferroptosis
dle04218  Cellular senescence
dle04310  Wnt signaling pathway
dle04722  Neurotrophin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111185755 (TP53)
   04310 Wnt signaling pathway
    111185755 (TP53)
   04071 Sphingolipid signaling pathway
    111185755 (TP53)
   04151 PI3K-Akt signaling pathway
    111185755 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111185755 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    111185755 (TP53)
   04210 Apoptosis
    111185755 (TP53)
   04216 Ferroptosis
    111185755 (TP53)
   04115 p53 signaling pathway
    111185755 (TP53)
   04218 Cellular senescence
    111185755 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111185755 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111185755 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    111185755 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111185755 (TP53)
   05202 Transcriptional misregulation in cancer
    111185755 (TP53)
   05206 MicroRNAs in cancer
    111185755 (TP53)
   05205 Proteoglycans in cancer
    111185755 (TP53)
   05203 Viral carcinogenesis
    111185755 (TP53)
   05230 Central carbon metabolism in cancer
    111185755 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111185755 (TP53)
   05212 Pancreatic cancer
    111185755 (TP53)
   05225 Hepatocellular carcinoma
    111185755 (TP53)
   05226 Gastric cancer
    111185755 (TP53)
   05214 Glioma
    111185755 (TP53)
   05216 Thyroid cancer
    111185755 (TP53)
   05220 Chronic myeloid leukemia
    111185755 (TP53)
   05217 Basal cell carcinoma
    111185755 (TP53)
   05218 Melanoma
    111185755 (TP53)
   05219 Bladder cancer
    111185755 (TP53)
   05215 Prostate cancer
    111185755 (TP53)
   05213 Endometrial cancer
    111185755 (TP53)
   05224 Breast cancer
    111185755 (TP53)
   05222 Small cell lung cancer
    111185755 (TP53)
   05223 Non-small cell lung cancer
    111185755 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111185755 (TP53)
   05014 Amyotrophic lateral sclerosis
    111185755 (TP53)
   05016 Huntington disease
    111185755 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111185755 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111185755 (TP53)
   05161 Hepatitis B
    111185755 (TP53)
   05160 Hepatitis C
    111185755 (TP53)
   05162 Measles
    111185755 (TP53)
   05168 Herpes simplex virus 1 infection
    111185755 (TP53)
   05163 Human cytomegalovirus infection
    111185755 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111185755 (TP53)
   05169 Epstein-Barr virus infection
    111185755 (TP53)
   05165 Human papillomavirus infection
    111185755 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111185755 (TP53)
   01522 Endocrine resistance
    111185755 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111185755 (TP53)
   03036 Chromosome and associated proteins [BR:dle03036]
    111185755 (TP53)
   03400 DNA repair and recombination proteins [BR:dle03400]
    111185755 (TP53)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    111185755 (TP53)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111185755 (TP53)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111185755 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD TAD2 CEP1-DNA_bind
Other DBs
NCBI-GeneID: 111185755
NCBI-ProteinID: XP_022451328
UniProt: A0A2Y9Q793
LinkDB
Position
Unknown
AA seq 387 aa
MEESQAELGVEPPLSQETFSDLWKLLPENNLLSSELSPAVDDLLLSPEDVANWLDERPDE
APQMPEPPAPAAPTPAAPAPATSWPLSSFVPSQKTYPGSYGFHLGFLHSGTAKSVTCTYS
PALNKLFCQLAKTCPVQLWVSSPPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERCSDYSD
GLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGM
NRRPILTIITLEDSNGNLLGRNSFEVRVCACPGRDRRTEEENFHKKGQSCPELPTGSAKR
ALPTGTSSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGESRAHS
SHLKSKKGQSPSRHKKLMFKREGPDSD
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggaggagtcgcaggcagaactcggcgtggagccccctctgagtcaggagacgttttca
gacttgtggaaactgcttcctgaaaacaaccttctgtcctctgagctctccccagccgtg
gatgacctgctgctgtccccagaagacgtcgcaaactggctggatgaacgtccagatgaa
gccccccaaatgccagagccccctgcgccagctgcccccaccccagccgccccagcacca
gccacctcctggcccctgtcgtcctttgtcccttcccagaagacctaccctggcagctat
gggttccatctaggtttcctacattccggaacagccaagtctgtaacctgcacgtattcc
cctgccctcaacaagctgttttgccagctggccaagacctgcccggtgcagctgtgggtc
agctcaccacccccgcccggcacccgggtccgcgccatggccatctataagaagtcagag
tacatgacggaggttgtgaggcgctgtccccaccatgagcgctgctctgactatagcgac
ggtctggcccctcctcagcatctgatccgggtggaagggaatttacgtgctgagtatttg
gacgacagaaacacttttcgacacagcgtggtggtgccctacgagccgcctgaggttggc
tctgactgtaccaccatccactacaacttcatgtgtaacagctcctgcatgggaggcatg
aaccggcggcccatcctcaccatcatcacactggaagactccaatggtaatctgctggga
cggaacagctttgaggtgcgtgtttgtgcgtgtcctgggagagaccgccgcacagaggaa
gaaaatttccacaagaaggggcagtcttgccctgagctgcccactgggagcgctaagcga
gcactgcctaccggcaccagctcctctccaccgcaaaagaagaaaccactggatggagaa
tatttcactcttcagatccgtgggcgtgaacgctttgagatgttccgagagctgaatgag
gccttggagctgaaggatgctcaggctggaaaggagccaggggaaagcagggctcactct
agccacctgaagtctaagaaggggcagtctccctcccgccataaaaaactgatgttcaag
agagaagggcctgactcagactga

DBGET integrated database retrieval system