KEGG   Delphinapterus leucas (beluga whale): 111185989
Entry
111185989         CDS       T05885                                 

Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00220  Arginine biosynthesis
dle00330  Arginine and proline metabolism
dle01100  Metabolic pathways
dle04020  Calcium signaling pathway
dle04066  HIF-1 signaling pathway
dle04146  Peroxisome
dle04371  Apelin signaling pathway
dle04926  Relaxin signaling pathway
dle05010  Alzheimer disease
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05133  Pertussis
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111185989
   00330 Arginine and proline metabolism
    111185989
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111185989
   04066 HIF-1 signaling pathway
    111185989
   04020 Calcium signaling pathway
    111185989
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111185989
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111185989
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111185989
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111185989
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111185989
   05014 Amyotrophic lateral sclerosis
    111185989
  09171 Infectious disease: bacterial
   05133 Pertussis
    111185989
   05152 Tuberculosis
    111185989
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111185989
   05145 Toxoplasmosis
    111185989
   05140 Leishmaniasis
    111185989
   05142 Chagas disease
    111185989
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     111185989
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 111185989
NCBI-ProteinID: XP_022451860
UniProt: A0A2Y9Q2E7
LinkDB
Position
Unknown
AA seq 1146 aa
MREGLGAACEAARPRLCRLLRRILRPQPACGPCRASPVTQDDPKCHNLGKHRNESPQPLT
GTAKQSPESLVKPAAPPSACPRHLRIKNWGSGMTFQDTLHHKAKGDLACKSRSCLGAIMN
PKSLTIGPRDKPTLPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNIR
SAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTIRGDPASVEFTQLCIDLGWKPKYGR
FDVVPLVLQADGRDPELFEIPPDLVFEVPMEHPKYEWFRELELKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKVASLWKDRAVIEINVA
VLHSFQKHNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEML
NYVLSPFYYYQVEAWKTHVWQDERRRPRRREIRFKVLVKAVLFASVLMRETMASRVRATI
LFATETGRSETLARDLGALFSCAFNPKVLCMDEYRLSHLEEEQLLLVVTSTFGNGDSPGN
GEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQIAPTGEGDE
LSGQEEAFRGWAVQTFKAACETFDVRGKHHIQIPKLYTANVTWDLHHYRLVQDSQPLDLN
KALSSMHAKHVFTMRLKSQRNLQSPKSSRTTLLVELSCEGSQGPSYLPGEHLGVFPGNQP
ALVQGILERVVDGPAPHQPMRLETLCENGSYWVRDKRLPTCSLSQALTYFLDITTPPTQL
LLRKLAQLATDEAERQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQLP
VLKPRYYSISSSRDHAPREIHLTVAVLTYRTRDGQGPLHHGVCSTWLSNLKPQDPVPCFV
RSASGFQLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDAEHKGLQSGRMTLVFGCRRPDE
DHLYREEMLEMTRKGVLHEVHTAYSRLPDQPKVYVQDILRQQLADEVLHVLHEDQGHLYI
CGDVRAARDVARTLKQLVATALSLTEEQVEDYFFQLKVGPLACGLGMQAKDMGQGARARG
VRFTTS
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgcgcgaggggctgggcgcggcgtgcgaggctgcccggccccgactctgccggctcctt
cgcaggatcctccggccgcagccagcctgcggcccctgccgagccagtccagtgacacag
gatgaccccaaatgtcacaacctcggcaagcaccggaatgagtctccccagcccctcacg
gggacagcaaagcagtctccagaatccctggtcaagccggctgcacccccatcagcctgc
ccacggcacctgaggatcaaaaactggggcagcgggatgactttccaagacacacttcac
cacaaggccaaaggggatctcgcttgcaagtccaggtcttgcctgggagccatcatgaac
cccaaaagtttgaccataggacccagggacaagcctaccctcccagatgagcttctacct
caagctattgaatttgtcaaccagtattatggctccttcaaagaggcaaaaatagaggaa
catctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccagctg
acgggagatgagctcatcttcgccaccaagcaggcctggcgcaacgccccccgctgcatc
gggaggatccagtggtccaacctgcaggtcttcgatgcgcggagctgttccacggcccag
gagatgttcgagcacatctgcagacacctgcgttatgccaccaacaacggcaacatcagg
tcggccatcaccgtgttcccccagcggagcgacgggaaacatgacttccgggtctggaac
gcccagctcatccggtatgccggctaccagatgcctgatggcaccatcagaggggaccct
gccagcgtggagttcacccagctgtgcatcgacctgggctggaagcccaagtacggccgc
ttcgatgtggtgcctctggtcctgcaggctgatggccgtgaccctgagctcttcgaaatc
cctcccgaccttgtgtttgaggtgcccatggaacatcccaagtatgagtggttccgggag
ctggagctgaagtggtatgccctgccggctgtagccaacatgctgctcgaggtgggtggc
cttgagttcccagggtgccccttcaacggctggtatatgggcacggagatcggagtccgg
gacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggaggatgggcctg
gaaacacacaaggtggcctcactctggaaagaccgggctgtcattgagatcaatgtcgct
gtgctccacagtttccagaagcataatgtgaccatcatggaccaccactcagctgcagag
tccttcatgaagtacatgcagaatgagtaccggtcccgagggggctgcccagctgactgg
atttggttggtccccccaatttctggaagcatcacccccgtgttccaccaggagatgtta
aattatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtctgg
caggatgagaggcggagaccccggagaagagagattcgattcaaagtcttggtcaaagcc
gtactctttgcgtcagtgctgatgcgtgagacaatggcttcccgggtcagagccacgatc
ctctttgcaacagagacaggaagatcggaaacactggcccgggacctaggggccttgttc
agctgtgccttcaaccctaaggttctctgcatggacgaatacaggctgagccatctggag
gaggaacagctactgctggtggtgaccagcacgttcgggaacggagactcccccggcaac
ggagagaaactgaagaagtccctcttcatgctgaaagaactcaccaacaagttcaggtat
gccgtgtttggcctcggctccagcatgtaccctcagttctgcgcctttgctcatgacatc
gaccagaagttgtcccagctgggggcttctcagatcgccccaacaggggaaggggacgag
ctcagcgggcaggaggaggccttccgtggctgggccgtgcaaaccttcaaggcagcctgt
gagacgttcgatgtccgaggcaaacatcacattcagatccccaagctctacactgccaat
gtgacctgggacctgcaccactaccggctcgtgcaagactcacagcctttggacctcaac
aaagccctcagcagtatgcacgccaagcatgtgttcaccatgaggctgaaatcgcagcgg
aatctacagagtccaaaatccagccgtaccaccctcctggtggaactctcctgtgagggc
agccaaggtccaagctacctgccgggagagcacctcggagttttcccaggcaaccagcca
gccctggtccaaggcatcctggagcgagtggtggatggccctgccccccaccaacccatg
cgcctggagaccctctgcgagaacggcagctactgggtcagggacaagcgactgcccacc
tgctcactcagccaggctctcacctatttcctggacatcaccaccccgccaacccagctg
ctgctccgaaagctggcccagctggccacggacgaggctgagaggcagaggctggagacc
ctgtgccagccgtctgattacaacaagtggaagttcaccaatagccccaccttcctggag
gtgctggaggaattcccgtccctgcgggtgtccgccagcttcctgctctcccagctgcct
gtcctgaagccccggtattactccatcagctcctccagggaccacgcacccagggagatc
cacctcaccgtggccgtgctcacgtaccgcacccgagacggccagggtcccctgcaccac
ggcgtctgcagcacatggctcagcaacctgaagccccaagacccggtgccctgctttgtg
cgaagtgccagcggcttccagctccccgaggacccctcccacccttgcatcctcatcggg
cctggcacgggcatcgcccccttccgcagcttctggcagcagcggcttcatgatgccgag
cacaaaggtctccagagtggccgcatgaccctcgtgttcgggtgccgccgcccagatgag
gaccacctctaccgggaagagatgttggagatgacccggaagggggtgctgcatgaggtg
cacacagcctattctcgcctgcctgaccagcccaaggtctacgttcaagacatcctgcgg
caacagctggcggacgaggtgctgcacgtgctccacgaggaccagggccacctctacatc
tgcggggacgtgcgcgcagcccgggatgtggcccgcaccctgaagcagctggtggccacc
gcgctgagcctaactgaggagcaggtggaggactatttcttccagcttaaggtagggccg
ctggcgtgtgggctcgggatgcaggccaaggacatgggccagggagccagggccaggggg
gtcaggttcacaacaagctga

DBGET integrated database retrieval system