KEGG   Delphinapterus leucas (beluga whale): 111186301Help
Entry
111186301         CDS       T05885                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform isoform X1
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00071  Fatty acid degradation
dle01212  Fatty acid metabolism
dle03320  PPAR signaling pathway
dle04152  AMPK signaling pathway
dle04714  Thermogenesis
dle04920  Adipocytokine signaling pathway
dle04922  Glucagon signaling pathway
dle04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111186301 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    111186301 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111186301 (CPT1B)
   04920 Adipocytokine signaling pathway
    111186301 (CPT1B)
   03320 PPAR signaling pathway
    111186301 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    111186301 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111186301 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dle03029]
    111186301 (CPT1B)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111186301 (CPT1B)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111186301 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 111186301
NCBI-ProteinID: XP_022452474
UniProt: A0A2Y9Q079
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFRLSREALKHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLFVVMTTLGSSYCNVDISMGLVCFIQRWLPEGCGPYRSPQTRTLLSMAIFSTGVWMTG
ILFFRQTLKLLLSYHGWLFEMHGQTSHFTRVWAMCVRLLSGQRPMLYSFQTSLPKLPVPS
VSATIHRYLESVQHLLDDEEYYRMETLAKEFQEKTAPRLQKYLVLKSWWAANYLQPPTHP
QVSDWWEEYVYLRGRTPLMVNSNYYVMDLVLVKNTDVQAARLGNIVHAMIMYRRKLDREE
IKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHLTDSRHVAVYHKGRFFKLWLYEGS
RLLKPRDLEMQFQRILDDPSPPQPGEERLAALTAGGRVEWAQVRQAFFGSGKNKAALDAI
ERAAFFVALDEESHRYDPEDEASLSLYGKALLHGSCYNRWFDKSFTLIAFKNGQLGLNTE
HAWADAPIIGHLWEFVLGTDSFDLGYSETGHCLGKPNPVLAPPQRLQWDIPEQCQAVIES
SYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAYFRDRGKFCLTYEAS
MTRMFREGRTETVRSCTCESTAFVQAMVQGRHLKADLQDLFRKAAEKHQNACRLAMTGAG
IDRHLFCLYVVSKFLGVSSPFLAEVLSEPWRLSTSQTAQFQIRMFDPNKYPNHLGAGGGF
GPVANDGYGVSYMIAGENTIFFHVSSKFSSSETNAQRFGNHIRQALLDIADLFQVPKADS
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcaccaggctgtggccttccagttcacggtgacgccagagggggtcgac
ttccggctcagtcgggaggccctaaaacacatctacctgtccggcataaactcctggaag
aaacgcctgattcgcatcaagaatggcatcctcaggggtgtgtaccctggcagccccacc
agctggctgttcgtcgtcatgacgacactgggttcctcctactgcaacgtggacatctcc
atggggctggtctgttttatccagagatggcttcctgagggatgtggcccctaccggagc
ccacagacgcggacacttctcagcatggccatcttctccacgggggtctggatgacgggc
atcctcttcttccgccaaaccctgaaactgctgctttcctaccacggttggctgtttgag
atgcacggccagaccagccacttcaccagagtctgggctatgtgtgtccgccttctgtcc
ggccagcggcccatgctctacagcttccagacatctctgcccaagttgcccgtgcccagc
gtgtcagccacgattcatcggtacctagaatccgtgcaacacttattggatgacgaggaa
tattaccgaatggagacgctggccaaggaattccaggagaagactgcccccaggctgcag
aagtacctggtactcaagtcatggtgggcagccaattatctccaacctcccacccacccg
caggtgagcgactggtgggaagagtatgtctaccttcgaggcaggactcccctcatggtg
aacagcaactattatgtcatggacttagtgctcgtcaagaacacagacgtgcaggcagcc
cgcctgggaaacattgtccacgccatgatcatgtatcgccgtaaacttgaccgtgaagag
atcaagcctgtgatggcgctgggcatcgtgcccatgtgctcctaccagatggagaggatg
ttcaacaccacccggatcccagggaaggacacagacgtgctgcagcacctcacagacagc
aggcacgtagccgtctaccacaagggccgtttcttcaagttgtggctctatgagggctcc
cgcctgctcaagcctcgggacctggagatgcaattccagaggatcctggatgacccctcc
ccaccccagcctggggaggagagactggcggccctcaccgcagggggaagagtggagtgg
gctcaggtacgccaggccttcttcggctccggcaagaacaaggctgccctggatgccatc
gagcgcgctgctttctttgtggctctggatgaggagtctcaccgctatgaccccgaagac
gaggccagcctcagcctctacggcaaggccttgctgcacggcagctgctacaacaggtgg
ttcgacaagtccttcactctcatcgctttcaagaacggccagctgggcctcaacacagaa
cacgcgtgggcagacgcccctatcatagggcacctctgggagtttgtcctgggcaccgac
agcttcgacctgggctactcagagactgggcactgtctgggcaaacccaaccctgtgctg
gccccccctcagcggctgcagtgggacattcctgagcagtgccaggcagtcatcgagagc
tcctaccaggtggccaaggcactggctgacgacgtggaattgtactgcttccagttcttg
ccctttggcaaaggcctcatcaagaagtgccggaccagccctgacgccttcgtgcagatc
gccctgcagctggcatacttccgggacagaggcaagttctgcctgacctatgaagcctcg
atgaccaggatgttccgggagggacggacagagaccgtacgttcctgcacctgcgagtcc
acggcctttgttcaggccatggtgcaggggcgccacctgaaagcagacctccaagatctg
ttccggaaagcagctgagaagcaccagaatgcgtgccgcctggccatgacaggggctggc
attgacaggcacctcttctgcctttacgtggtttccaagttcctgggggtcagctcccct
ttcctggctgaggtgctctcagaaccctggcgcctctctaccagccaaactgctcaattc
cagatccgcatgtttgacccaaacaagtaccccaatcacctgggtgctggcggtggcttt
ggccctgtagctaatgatggctacggggtttcctacatgatcgcgggtgagaacaccatc
ttcttccacgtctccagcaagttctcaagctcagagacaaatgcccagcgctttgggaac
cacatccgccaagctctgctggacatcgctgatcttttccaagttcccaaggctgacagc
tga

DBGET integrated database retrieval system