KEGG   Delphinapterus leucas (beluga whale): 111186578
Entry
111186578         CDS       T05885                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta isoform X1
  KO
K05060  interleukin 6 signal transducer
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111186578 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111186578 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111186578 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111186578 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111186578 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186578 (IL6ST)
   05203 Viral carcinogenesis
    111186578 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111186578 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111186578 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111186578 (IL6ST)
   04090 CD molecules [BR:dle04090]
    111186578 (IL6ST)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL6/12 receptor family
   111186578 (IL6ST)
CD molecules [BR:dle04090]
 Proteins
  111186578 (IL6ST)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 111186578
NCBI-ProteinID: XP_022453021
UniProt: A0A2Y9Q671
LinkDB
Position
Unknown
AA seq 918 aa
MLTLQTWIVQALFIFLTTESVGELLDPCGHIHPESSVVQLGSNFTAVCVLKEKCMDYFHV
NANYIFWKTNHVIVPFEQYTVINRTASSVTFTDISLLNIQLTCNIRTFGQIDQNVYGIRI
ISGLPPEKPKNLSCIVNEGKKMMCQWDPGRETHLETNYTLKSEWATEKFDDCKAKRDTRT
SCTVDYSPVYFVNIEVWVEAENALGTVTSDHINFDPVDKVKPNPPHNLSVSNSEELSSIL
KLTWINSSIKSFIRLKYNIQYRTRDASTWNQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGFWSDWSEEASGITYEDRPSKAPSFWYKIEPSHTHGCRSVQLIWKTLPPFEAH
GKILDYEVTLTRWKSRLQNYTVNDTKLTVNLTNDRYIATLTARNLVGKSDASVLTIPAWG
FQATHPITDLKAFPKDNVLWVEWTAPNESVNRYILEWCVLSDKSPCIPDWQQEDGTVHRT
YLRGNLAESKCYLITVTPVYADGPGLPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHFNSKDQMYPDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINT
EGHSSGIGGSSCMSSSRPSISSSDENESAQNTSSTVQYSTVVHSGYRHQVPSVQVFSRSE
STQPLLDSEERPEDLQLVDNVDSSDSILPRQQYFKQNCSQHETSPDISHFERSKQVSSVN
EGAFVRLKQQQISDHISQPYGSGQMKMFQEVPAADAFGPGTEGQVERFETVGMEATIDEG
APKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttgacattgcaaacttggatagtgcaagccttgtttattttcctcaccactgaatct
gtaggagaacttctagatccatgtggtcatatccaccctgaatcttcagttgtacaactt
ggttctaatttcacagcagtttgtgtgctaaaggaaaaatgtatggattattttcatgtg
aatgctaattacattttctggaaaacaaaccatgttattgttccttttgaacaatatact
gtcataaacagaacagcatctagtgtcacatttacagatatatctttattaaatattcaa
ctcacttgcaacattcgtacatttggacaaattgatcagaatgtttatggaatcagaata
atttcaggcctgcctccagaaaaacctaaaaatttgagttgcattgtgaacgaaggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacgcacctggaaacaaactacacttta
aaatctgaatgggccacagagaagtttgatgattgtaaagcaaaacgtgacacccgcacc
tcatgtactgttgattattctcctgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgctcttgggacggttacctcagatcatatcaattttgatcctgtagataaagtg
aagcccaatccaccacataatttatcagtcagcaactcagaggaactgtctagtatttta
aaattgacatggatcaactcaagtattaagagttttataagactgaaatataacattcaa
tataggaccagagatgcctcaacttggaaccagattcctcctgaagatacagcatctacc
cgatcttcattcactgtccaggaccttaaaccttttacagagtatgtgtttaggattcgt
tgtatgaaggaagatggtaaaggattttggagtgactggagtgaagaagcgagtgggatc
acatatgaagatagaccatccaaggcaccaagcttctggtataagatagagccatctcat
actcatggctgtagatctgtacaactcatatggaagacattgcctccttttgaagcccat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacgtttacaaaattac
acagttaacgacacaaaactgacagtaaacctcacaaatgatcgctacatagcaactctg
acagcaagaaatctggttggcaaatcagatgcatctgttttaactatccctgcctggggt
tttcaagctactcaccccataacggatcttaaagcatttcccaaggacaatgtgctttgg
gtagaatggactgctccaaatgaatctgtaaacagatatatacttgagtggtgtgtgtta
tcagataaatcgccctgtatcccagactggcaacaagaagatggtactgtacatcgcacc
tatttaagaggaaacctagcagagagcaaatgttatttgataacagtcactccagtgtat
gctgatggaccaggactccccgagtctataaaggcataccttaaacaagctccaccttcc
aaaggacctactgtccggacaaaaaaagtggggaaaaatgaagctgtcttagagtgggac
caacttcctgttgatgttcagaatggatttatcagaaattatactatattttatagaacc
atcattggaaatgaaactgctgtgaatgtggattcttcccacacagaatatacgctgtcc
tctttgactagtgacactttgtatatggtacgaatggcagcatatacagacgaaggtgga
aaggatggtccagaattcacttttactacaccaaagtttgctcaaggagaaattgaagct
attgttgtacctgtttgcttagcattcctattgacaacccttttgggagtattattctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacacacctccaaggcattttaattcaaaagatcaa
atgtatccagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgacaaa
aagcctttcccagaagatctaaaatcattggacctattcaagaaggaaaaaattaatact
gaaggacacagcagtggtattggagggtcttcatgcatgtcatcttctaggccaagcatt
tctagcagtgatgaaaatgaatctgcacagaacacgtcgagtactgtccagtattccact
gtggtacatagtggctacagacaccaggtgccatcggtccaagtgttctcaagatccgag
tccacccagcccttgttagattctgaagaacggccagaagatctacagctggtagataat
gtagatagcagtgacagcattttgcccaggcaacagtatttcaaacagaactgcagtcaa
catgaaaccagtccagatatttcgcattttgaaaggtcaaagcaagtttcatcagtcaat
gaaggagcttttgttagacttaaacagcaacagatttcagatcatatttcacagccctat
ggatctgggcagatgaaaatgtttcaggaagttcctgcagcagatgcttttggtccaggc
accgagggacaagtagagagatttgaaacagttgggatggaggctacaattgatgaagga
gcgcctaaaagttacttaccacagactgtaagacgaggtggctacatgcctcagtga

DBGET integrated database retrieval system