KEGG   Delphinapterus leucas (beluga whale): 111187099
Entry
111187099         CDS       T05885                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04115  p53 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04370  VEGF signaling pathway
dle04919  Thyroid hormone signaling pathway
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05134  Legionellosis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111187099 (CASP9)
   04151 PI3K-Akt signaling pathway
    111187099 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111187099 (CASP9)
   04215 Apoptosis - multiple species
    111187099 (CASP9)
   04115 p53 signaling pathway
    111187099 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111187099 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187099 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111187099 (CASP9)
   05212 Pancreatic cancer
    111187099 (CASP9)
   05215 Prostate cancer
    111187099 (CASP9)
   05213 Endometrial cancer
    111187099 (CASP9)
   05222 Small cell lung cancer
    111187099 (CASP9)
   05223 Non-small cell lung cancer
    111187099 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111187099 (CASP9)
   05012 Parkinson disease
    111187099 (CASP9)
   05014 Amyotrophic lateral sclerosis
    111187099 (CASP9)
   05016 Huntington disease
    111187099 (CASP9)
   05020 Prion disease
    111187099 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    111187099 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111187099 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    111187099 (CASP9)
   05152 Tuberculosis
    111187099 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111187099 (CASP9)
   05161 Hepatitis B
    111187099 (CASP9)
   05160 Hepatitis C
    111187099 (CASP9)
   05164 Influenza A
    111187099 (CASP9)
   05162 Measles
    111187099 (CASP9)
   05168 Herpes simplex virus 1 infection
    111187099 (CASP9)
   05163 Human cytomegalovirus infection
    111187099 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111187099 (CASP9)
   05169 Epstein-Barr virus infection
    111187099 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111187099 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111187099 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111187099 (CASP9)
   01002 Peptidases and inhibitors [BR:dle01002]
    111187099 (CASP9)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     111187099 (CASP9)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111187099 (CASP9)
Peptidases and inhibitors [BR:dle01002]
 Cysteine peptidases
  Family C14: caspase family
   111187099 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 111187099
NCBI-ProteinID: XP_022454114
UniProt: A0A2Y9Q4X2
LinkDB
Position
Unknown
AA seq 452 aa
MNEADRRLLRQSRVRLVGELQVAALWDALLNRELFTPDMIEDIQRAGSGSRRDQARQLIT
DLETRGSQALPLFISCLEDTGQETLASLLRTSRQAAKQDPEAIRPLNLKPVVLGPVSLKP
KELRGAKQDPSRPSQGKLAPVVLGPEELWPAKLRPEVLRPEAPKPVDIGSGGFSEIRAQD
RAKGNADLAYVLNADPCGHCLIINNVNFCHESGLRTRTGSSIDCERMQQRFHLLHFMVDV
KCNLTAKQMVQALVELARRDHSALDCCVVVILSHGCQASHLQFPGAVYGMDGYPMSVERI
VNIFNGTGCPSLGGKPKLFFIQACGGEQKDQGFEVASTSPEDRTPDSDPEPDATPFQEGP
VTVDQPDAVSSLPTPSDILVSYSTFPGFVSWRDTKSGSWYIETLDSIFEQWAHCEDLQTL
LLRVANAVSVKGVYKQIPGCFNFLRKKLFFKM
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgaacgaggccgaccggcggctcctgcggcagtcccgggtgcggctggtcggcgagctg
caggtggccgcgctctgggacgctctgttgaatcgcgagctcttcacccccgacatgatc
gaggacatccagcgggcaggctctgggtctcggcgagatcaggccaggcagctgatcaca
gatctagagacccgagggagtcaggcccttcctttgttcatctcctgcttagaggacaca
ggccaggagactctggcttcgttactgagaaccagcagacaagcagcaaagcaggatcca
gaggccatcagacccctgaacctcaagcctgtggtgctcggaccagtgagcctcaaacca
aaggagctgagaggggcgaagcaggatccatcgaggccgagccaaggaaaactcgctcca
gtggtgctggggcctgaggagctctggccagccaagctcaggcccgaggttctcagacca
gaggcacccaagccagtggacattggttctggaggattcagtgaaatccgtgctcaggac
agagccaagggaaatgccgacttggcatacgtcctgaacgcagacccctgtggacactgc
ctcattatcaacaatgtgaacttctgccacgagtcggggctcaggacccgcacgggctcc
agtattgactgtgagaggatgcagcaacgcttccacttgctgcatttcatggtggacgtg
aagtgtaacctgactgccaagcaaatggtccaggctttggtggagctggcgcggcgggac
cacagtgctctggactgctgcgtggtggtcatcctctctcatggctgtcaggctagccac
ctccagttcccgggcgctgtttatggcatggatggatatcccatgtctgtcgagagaatt
gtgaacatcttcaatggaactggctgccccagcttgggagggaagcccaagctcttcttc
atccaggcctgtggcggagagcagaaagaccaggggtttgaggtggcttccacttcccct
gaagacaggacccctgacagcgaccctgagccagatgctaccccgttccaggaaggccca
gtcaccgtcgaccagccggatgccgtgtctagtttgcccacacctagtgacatcttggtg
tcctactccaccttcccaggttttgtctcctggagggataccaagagtggctcctggtac
atcgagaccctggacagcatttttgagcagtgggctcactgcgaggaccttcagacactc
ttgctcagggttgctaatgctgtttcagtgaaaggagtttacaaacagattcctggctgt
tttaatttcctccggaaaaaacttttctttaaaatgtaa

DBGET integrated database retrieval system