KEGG   Delphinapterus leucas (beluga whale): 111187191
Entry
111187191         CDS       T05885                                 

Gene name
ZBTB17
Definition
(RefSeq) zinc finger and BTB domain-containing protein 17 isoform X1
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111187191 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187191 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    111187191 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111187191 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111187191 (ZBTB17)
   04121 Ubiquitin system [BR:dle04121]
    111187191 (ZBTB17)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    111187191 (ZBTB17)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     111187191 (ZBTB17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2H2_6 Zn-ribbon_8 zinc_ribbon_15 zf-C2HC_2 zf_UBZ zf-BED zf-C2HE zf-Di19 XPA_N Packaging_FI HypA DUF3268
Other DBs
NCBI-GeneID: 111187191
NCBI-ProteinID: XP_022454303
UniProt: A0A2Y9QFT2
LinkDB
Position
Unknown
AA seq 792 aa
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSSENVDDVLAVASFLQMQDIITACHALKSLAEPAAS
PGESMEASALEVGDKRAKEEKTAATTLSELDLARSSPPAGLGREPKEERGGQAESAASGA
EQTEKADAPREPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEREEEGAVPAV
VKEEGPPLEKGEAPEESEESASTDSGQELGAEARGLRSGTYGDRTESKAYGSVIHKCEDC
GKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSY
RLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPT
SKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKR
HLRIHSGEKPYVCVHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQ
HTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGE
KPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEALA
ATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANS
LAQHVRIHTAQALVMFQTDADFYQQYGPGSTWPAGQVLQAGELVFRPRDGADGQPALAET
PPTAPECPPSAE
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggattttccccagcacagccagcatgtcttggagcagctgaaccagcagcggcaactg
gggcttttgtgtgactgcacttttgtggtggatggtgttgactttaaggctcataaagca
gtgctggcggcctgcagcgagtacttcaagatgctcttcgtggaccagaaggatgtggtg
cacctggacatcagtaacgcggcaggcctggggcaggtgctggagtttatgtacacggct
aagctgagcctgagctctgagaacgtggacgatgtgctggctgtggccagcttcctgcag
atgcaggacatcatcacggcctgccatgccctcaagtcactggccgagccggctgccagc
cctggggagagtatggaggcctcggccttggaagtgggggacaagagagccaaagaagag
aagacggctgccactacactgagcgagctggacctagccagaagcagtccacccgcgggc
ctgggcagggagcccaaagaggagcgaggcggccaggctgagagcgcggccagtggtgca
gagcagacggagaaggccgatgccccccgggagcctgtggagctcaagccggaccccacg
agcggcatggctgctgctgaggccgaggccgccttgtcggagagctcagagcaagaaatg
gaggtggagccagccaggaagggagaagaacgagaggaggagggcgccgtgcccgcggtg
gtcaaggaggaggggccgccgctggaaaagggcgaggcccccgaggagagcgaggagtcg
gccagcacggactcgggccaggagctcggcgcggaggcacggggcctgcgctcgggcacc
tacggcgaccgcacggagtccaaggcctacggctccgtcatccacaagtgcgaggactgt
gggaaggagttcacgcacacgggcaacttcaagcggcacatccgcatccacacgggcgag
aagcccttctcgtgccgggagtgtagcaaggccttctccgacccggccgcctgcaaggcc
cacgagaagacccacagcccgctgaagccatacggctgcgaggagtgcggcaagagctac
cggctcatcagcctgctgaacctgcacaagaagcggcactcgggcgaggcgcgctaccgc
tgcgaggactgcggcaagctcttcaccacgtcgggcaacctcaagcggcaccagctggtg
cacagcggcgagaagccctaccagtgcgactactgcggccgctctttctccgaccccacg
tccaagatgcgccacctggagacgcacgacaccgacaaggagcacaagtgccctcactgc
gacaagaagttcaaccaggtggggaacctgaaggcccacctgaagatccacatcgccgac
gggcccctcaagtgccgggagtgtgggaagcagttcaccacctcagggaacctgaagcgg
caccttcggattcacagtggtgagaagccctacgtgtgcgtccactgccagcggcagttc
gctgaccccggcgccctgcagcggcacgtccgcatccacacgggtgagaagccatgccag
tgcgtgatgtgcggcaaagccttcacccaggccagctccctcatcgcccacgtgcgccag
cacaccggggagaagccttacgtctgcgagcgttgcggaaagagatttgtccagtctagc
cagctggccaatcacatccgccaccatgacaacatccgtcctcacaagtgcagcgtgtgc
agcaaggccttcgtgaacgtgggggacctgtccaagcatatcattatccacactggagag
aagccttacctgtgtgacaagtgcggtcgcggcttcaaccgggtggacaaccttcgttcc
catgtgaagactgtgcaccagggcaaggcaggcatcaaaatcctggagccagaggagggc
ggtgaggtcagcgtggtcaccgtcgatgacatggtcacgctggccactgaggcactggcg
gcaacggccgtcactcagctcacagtggtgccagtgggggcggcggtgaccgcagatgag
acagaagtacttaaagccgagatcagcaaagctgtgaagcaagtgcaggaagaagatccc
aacactcacatcctctacgcttgtgactcctgtggagataagttcctggatgccaacagc
ctggcccagcacgtgcggatccacacggcccaggcactggtcatgttccagacggatgcg
gacttctaccagcagtacgggccaggcagcacgtggccggccggacaggtgctgcaggct
ggggagctagtcttccgccctcgggatggggctgatgggcagccggccctggcagagaca
cctcccacagcccctgaatgtccaccatctgctgagtga

DBGET integrated database retrieval system