KEGG   Delphinapterus leucas (beluga whale): 111187198
Entry
111187198         CDS       T05885                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11-like
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04014  Ras signaling pathway
dle04072  Phospholipase D signaling pathway
dle04360  Axon guidance
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04670  Leukocyte transendothelial migration
dle04722  Neurotrophin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04931  Insulin resistance
dle05168  Herpes simplex virus 1 infection
dle05205  Proteoglycans in cancer
dle05211  Renal cell carcinoma
dle05220  Chronic myeloid leukemia
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111187198
   04630 JAK-STAT signaling pathway
    111187198
   04072 Phospholipase D signaling pathway
    111187198
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111187198
   04650 Natural killer cell mediated cytotoxicity
    111187198
   04670 Leukocyte transendothelial migration
    111187198
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111187198
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111187198
  09158 Development and regeneration
   04360 Axon guidance
    111187198
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111187198
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111187198
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111187198
   05211 Renal cell carcinoma
    111187198
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111187198
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111187198
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111187198
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111187198
Protein phosphatases and associated proteins [BR:dle01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    111187198
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 111187198
NCBI-ProteinID: XP_022454312
UniProt: A0A2Y9QG58
LinkDB
Position
Unknown
AA seq 617 aa
MTSRRWFHPNTGGAEAERLLLSKGQHGSFLARPSKSRPGGFTLSVRRHNEVTHIKIQNTG
DYYDLYGGEKFATLAELVQHYTGQRGGLLRERGGAPVELWHPLSCQDPTSERWYHGHLSG
QEAEKLLMQKGRPGSFLVRESQSKPGDFVLSVLTQQLDRADRQARVTHVMIHFQPDGKYD
VGGGKRFDTLGDLVECYRKNPLVERSGTVVHLQQPLKTTRISATSIESRVRELNEAMDAS
EKAKQGFWEEFEMLQQQECRLLYPRKEGQRLENKPKNRYKNILPFDTTRVILRDVEDSAP
GADYINANYIRSDPEEKPGHGPGKVYIATQGCLPTTAAAFWAMVHQENTRVIVMTTREVE
RGRNKCFRYWPELHGSQEYGRLRVCNVAEHQAQGYCVRELQVWRADQEESPRTVAHCQYF
GWPDHGVPAEPTGVLGFLDEVNRAQSGMPGAGPMVVHCSAGIGRTGTIIVIDILVDVIRR
QGLDCDIDVPKTIQHVRRQRSGMVQTEAQYKFVYLALQRYIRGEQLRLREQVCWHLSLQL
AAGVQRGDPGNGHGCGPPAERAGHDLATRLACGPGGCHPRKALQAEDVGAGELLGCPEDV
VVAREADGAFQWGGRLL
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgacctcgcgcaggtggtttcatcccaacaccggtggggctgaggcggagcggctgctc
ctgtccaagggccagcacgggagcttcctggcaagacccagcaagagccgcccagggggc
ttcacgctgtccgtcaggcgccacaacgaggtgacccacatcaagatccagaacacaggc
gactactatgatctgtacggaggggagaagttcgcgacgctggccgagctggtgcagcac
tacacaggccagcgcgggggattgctccgagagcgtggtggggcccccgtggagctctgg
cacccgctgagctgccaggaccccacgtcggaacggtggtaccacgggcacctgtctggc
caggaggccgagaagctgctgatgcagaaggggcgtccgggcagcttcctggttcgggag
agtcagagcaaacctggggacttcgtgctgtcagtgctcacacagcagctggacagggcg
gaccgccaggcacgcgtcacccatgtcatgatacacttccagccagatgggaagtacgat
gtgggaggtggcaagaggtttgacaccctgggagatctggtggaatgctacaggaagaac
cctctggtggagaggtcggggactgtagtgcacctccagcagcccctcaagaccacgaga
atcagcgccacaagcattgagagccgtgtgcgggagctcaacgaggccatggatgccagc
gagaaggccaagcagggcttctgggaggagttcgagatgctgcagcagcaggaatgccgg
ctcctgtatccccggaaagagggccagcggctggagaacaagcccaagaaccgatacaag
aacatcctcccctttgataccacccgtgtcatcctgcgtgatgtggaggacagcgcgcct
ggagccgactacatcaacgccaactacatcaggagtgacccagaggagaagccaggccac
ggaccaggcaaggtgtacatcgccacccagggctgtctgccaactacggcggctgccttc
tgggccatggtgcaccaggagaacacgcgtgtcatcgtcatgaccaccagagaggtggag
cgaggccggaacaagtgtttccgatactggccagagctgcacggcagccaagagtatggc
cgcctgcgtgtgtgcaacgttgctgagcaccaggcccagggctattgtgtgagggagctg
caggtgtggcgggcagaccaggaggagtcaccgcgtacagtggcgcactgccagtacttc
ggctggccggaccacggagtcccggccgagcccaccggcgtccttggcttcctggacgag
gtgaaccgggcccagagcggcatgccgggggccggacccatggtagtgcactgcagcgcc
ggcatcggacgcactggcacaatcattgtgattgacatcttggtggacgtcattcgcagg
caggggctggactgcgacatcgacgtccccaagacgatccagcatgtgcggcggcagcgc
tcggggatggtgcagaccgaggcgcagtacaagttcgtgtacctggcgctgcagcggtac
atccggggcgagcagctacgcctgcgcgagcaggtgtgctggcatctgagcctgcagctg
gcggctggtgtgcagcgcggggaccccggcaatgggcacggctgtgggccgccggcagaa
cgggcagggcacgacctcgctacccggctggcctgtgggccgggcggctgccatccgcgc
aaggcactccaggcagaagacgtgggtgcaggagagctccttgggtgtcctgaagatgtt
gtcgtagcccgagaagcagatggagcattccagtggggaggccgccttctctga

KEGG   Delphinapterus leucas (beluga whale): 111188123
Entry
111188123         CDS       T05885                                 

Gene name
PTPN11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04014  Ras signaling pathway
dle04072  Phospholipase D signaling pathway
dle04360  Axon guidance
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04670  Leukocyte transendothelial migration
dle04722  Neurotrophin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04931  Insulin resistance
dle05168  Herpes simplex virus 1 infection
dle05205  Proteoglycans in cancer
dle05211  Renal cell carcinoma
dle05220  Chronic myeloid leukemia
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111188123 (PTPN11)
   04630 JAK-STAT signaling pathway
    111188123 (PTPN11)
   04072 Phospholipase D signaling pathway
    111188123 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111188123 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    111188123 (PTPN11)
   04670 Leukocyte transendothelial migration
    111188123 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111188123 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111188123 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    111188123 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111188123 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111188123 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111188123 (PTPN11)
   05211 Renal cell carcinoma
    111188123 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111188123 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111188123 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111188123 (PTPN11)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111188123 (PTPN11)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    111188123 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 111188123
NCBI-ProteinID: XP_022456026
UniProt: A0A2Y9QEG1
LinkDB
Position
Unknown
AA seq 623 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPYPNQMFLLINIIFFKD
GESEAKERYSIDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPRKSYIATQGCL
QNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAH
DYTLRELKLSKVGQALLQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIT
DAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQ
YRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLTDQATGDQSPLPPCTPTPSCA
EMREDNARVYENVGLMQQQKSFR
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggcgtggaggcagaaaacctactg
ttgacaagaggagttgatggcagttttttggcaaggcccagtaaaagtaaccctggagac
tttacactttctgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacttgtatggaggggagaagtttgccactttggctgaattggtccagtat
tacatggaacatcatgggcaattaaaagagaagaatggagatgttattgagctcaaatat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacatctgtctgggaaa
gaagcagagaaattattaaccgagaaaggaaaacacggtagctttcttgtgcgggagagc
cagagccaccctggagattttgttctctctgtccgaaccggagatgacaaaggggagagc
aatgacggcaagtctaaagtgacccatgttatgatccgctgtcaggaactgaaatatgat
gttggtggaggagaacggtttgactctttgacagatctcgtggagcattacaagaagaat
cctatggtagaaacattgggcacagtactacaactcaagcagcccctcaacacaactcgt
atcaatgctgctgaaatagaaagtcgggttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggaatgcaaa
cttctctacagcagaaaagagggtcagaggcaagagaataaaaacaaaaatagatataaa
aacatcctgccctatcccaatcagatgtttcttctgattaacatcatattctttaaagat
ggggagtctgaagcaaaagaacgttattctattgaccacaccagggttgtcctacacgat
ggtgatcccaatgagcctgtttcagattacatcaacgcaaacatcatcatgcctgaattt
gaaaccaagtgcaacaactcaaagcccagaaagagttacattgccacacagggctgcctg
caaaacacagtgaatgacttttggcggatggtgtttcaagagaactcccgagtgattgtc
atgacaacaaaagaagtggagagaggaaagagtaaatgtgtcaaatactggcctgatgag
tatgcgctaaaagaatacggggtcatgcgcgttaggaacgtcaaagaaagtgctgctcat
gactatacgttaagagaacttaaactttcgaaggttggacaagctctactccaggggaat
acggagagaacggtctggcaataccactttcggacctggccggaccacggagtgcccagt
gaccccgggggcgtgctggacttcctggaggaggtccaccataagcaggagagcatcacg
gacgcggggcctgtggtggttcactgcagtgctggaattggccgaacagggacgttcatt
gtgattgatattcttattgacatcatcagagagaaaggtgtcgactgtgacattgacgtt
cccaaaaccattcagatggtgcggtctcagaggtcagggatggtccagacagaagcacag
taccgattcatctatatggccgtccagcattatattgaaacactacagcgcaggattgaa
gaagagcagaaaagcaagaggaaagggcacgaatacacaaatattaagtattccctgacg
gaccaggcaactggagatcagagtcccctcccgccttgtaccccaacgccgtcctgtgca
gaaatgagagaagataatgctagagtctatgaaaatgtgggtctgatgcagcagcagaaa
agtttcagatga

DBGET integrated database retrieval system