KEGG   Delphinapterus leucas (beluga whale): 111187265
Entry
111187265         CDS       T05885                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04066  HIF-1 signaling pathway
dle04072  Phospholipase D signaling pathway
dle04136  Autophagy - other
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04371  Apelin signaling pathway
dle04613  Neutrophil extracellular trap formation
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
dle04714  Thermogenesis
dle04910  Insulin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04920  Adipocytokine signaling pathway
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05022  Pathways of neurodegeneration - multiple diseases
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05221  Acute myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111187265 (MTOR)
   04371 Apelin signaling pathway
    111187265 (MTOR)
   04630 JAK-STAT signaling pathway
    111187265 (MTOR)
   04066 HIF-1 signaling pathway
    111187265 (MTOR)
   04072 Phospholipase D signaling pathway
    111187265 (MTOR)
   04151 PI3K-Akt signaling pathway
    111187265 (MTOR)
   04152 AMPK signaling pathway
    111187265 (MTOR)
   04150 mTOR signaling pathway
    111187265 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111187265 (MTOR)
   04136 Autophagy - other
    111187265 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    111187265 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111187265 (MTOR)
   04659 Th17 cell differentiation
    111187265 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111187265 (MTOR)
   04920 Adipocytokine signaling pathway
    111187265 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    111187265 (MTOR)
   04919 Thyroid hormone signaling pathway
    111187265 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    111187265 (MTOR)
   04213 Longevity regulating pathway - multiple species
    111187265 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    111187265 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187265 (MTOR)
   05206 MicroRNAs in cancer
    111187265 (MTOR)
   05205 Proteoglycans in cancer
    111187265 (MTOR)
   05230 Central carbon metabolism in cancer
    111187265 (MTOR)
   05231 Choline metabolism in cancer
    111187265 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111187265 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111187265 (MTOR)
   05212 Pancreatic cancer
    111187265 (MTOR)
   05225 Hepatocellular carcinoma
    111187265 (MTOR)
   05226 Gastric cancer
    111187265 (MTOR)
   05214 Glioma
    111187265 (MTOR)
   05221 Acute myeloid leukemia
    111187265 (MTOR)
   05215 Prostate cancer
    111187265 (MTOR)
   05224 Breast cancer
    111187265 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111187265 (MTOR)
   05014 Amyotrophic lateral sclerosis
    111187265 (MTOR)
   05016 Huntington disease
    111187265 (MTOR)
   05017 Spinocerebellar ataxia
    111187265 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    111187265 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111187265 (MTOR)
   04931 Insulin resistance
    111187265 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111187265 (MTOR)
   05168 Herpes simplex virus 1 infection
    111187265 (MTOR)
   05163 Human cytomegalovirus infection
    111187265 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111187265 (MTOR)
   05165 Human papillomavirus infection
    111187265 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111187265 (MTOR)
   01522 Endocrine resistance
    111187265 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111187265 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111187265 (MTOR)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111187265 (MTOR)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   111187265 (MTOR)
Membrane trafficking [BR:dle04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    111187265 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ
Other DBs
NCBI-GeneID: 111187265
NCBI-ProteinID: XP_022454454
UniProt: A0A2Y9Q5U1
LinkDB
Position
Unknown
AA seq 2471 aa
MYPSSPFAFLSFPASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAG
DTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVA
VWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFDETLAKEKGMNR
DDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFT
SFQAMQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESRCCRDLMEEKFDQVCQWV
LKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQAL
GLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGI
QQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGM
PKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKE
IRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLA
SLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQI
LTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINN
VLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYVVEP
YRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSL
SESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITF
IFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTL
MREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLL
AAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVDRLTESLDFTDYASRIIH
PIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIV
KGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVSK
DDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDEL
IRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKAL
HYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWE
DALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAA
AAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTA
MAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKIL
MVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVT
YAYMKNMWKSARKIDAFQHMQHFVQTVQQQAQHAIATEDQQHKQELHKLMARCFLKLGEW
QLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKL
RHASGANITNVATAATTAATATATSTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLL
MYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQV
IPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNM
CEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMM
ERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQL
TSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSN
GHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIG
WVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDD
LARLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDF
GDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVL
EAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPES
IHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENL
CQCYIGWCPFW
NT seq 7416 nt   +upstreamnt  +downstreamnt
atgtacccttcctcaccttttgctttcctctcttttccagccagcctcataggagtggaa
ggtgggaatgccacccgaatcggaagatttgctaactaccttcggaacctcctcccctcc
aatgacccagttgtcatggaaatggcatccaaggccatcggtcgcctcgccatggcaggg
gacacgtttaccgctgagtatgtggagtttgaggtgaagcgagccttggaatggctgggt
gctgaccgcaacgagggccggagacatgcggctgtcctggttcttcgtgagctggccatc
agcgtccccaccttcttcttccagcaagtgcagcccttctttgacaatatttttgtggcc
gtgtgggaccccaaacaggccatccgtgagggagctgttgctgcccttcgtgcctgtctg
atcctcaccacccagcgggagccaaaggagatgcagaagccacagtggtacaggcacacg
tttgaggaagcagagaaggggtttgatgagaccttggccaaggagaagggcatgaatcgc
gatgatcggatccacggagccttactgatcctcaacgagctggttcgcatcagcagcatg
gagggagagcgcctgagagaagaaatggaagaaatcacacagcagcaattggtacatgac
aagtactgcaaggatctcatgggcttcggaacgaaacctcgtcacatcacccccttcacc
agtttccaggccatgcagccccagcagtcaaacgccttggtgggactgctggggtacagc
tctcaccaaggcctcatgggcttcggggcttcccccagcccagcgaagtccaccctggtg
gagagtcgctgctgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtg
ctgaagtgcaggaatagcaagaactcgctgatccaaatgacaatcctgaatttattgccc
cgcttggctgccttccgaccttctgccttcacagatacccagtatctccaagataccatg
aaccatgtcctaagctgtgtcaagaaggagaaggaacggacagcagccttccaagccctg
gggctactttctgtggctgtgaggtctgagtttaaggtctatttacctcgtgtgctggac
atcatccgagcagccctgcctcctaaggactttgcccataagagacagaaggcaatgcag
gtggatgccacggtgttcacctgcatcagcatgctggcccgagcgatggggccgggcatc
cagcaggacatcaaggagctgctggagcccatgctggcggtgggcctgagccctgccctc
acagctgtgctctacgacctgagccgtcagattccacagctgaaaaaggacatccaagat
ggactcctgaagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatg
cccaagggcctggcccatcagctggcttctcctggcctcacgaccctccctgaggccagc
gatgtgggcagcattacccttgccctccgaactcttggcagttttgaatttgaaggccac
tctctgacccagtttgtccgccactgtgcggatcacttcctgaacagtgagcacaaggag
atccgcatggaagccgcccgcacctgctcccgcctgctcacgccctctgtccacctcatc
agtggccatgctcacgtggttagccagaccgcagtgcaagtggtggcggatgtgctcagc
aaactgctcgtggttgggataacagatcctgaccccgacatccgctactgtgtcttggca
tccctggatgagcgctttgacgcacacctggcccaggcagagaatctgcaggccctgttt
gtggccctgaatgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccgg
ctcagcagcatgaacccagccttcgtcatgcccttcctgcgcaagatgctcatccagatt
ttgacagagctggagcacagcggcattggaagaatcaaggaacagagtgcccgcatgctg
gggcacctggtctccaatgccccccgactcatccgcccctacatggagcctatcctgaag
gctttaattttgaaactgaaagatccagaccctgatccaaacccgggtgtgatcaataat
gtcctggctacaataggagagttggctcaggttagtggcctagaaatgaggaaatgggtt
gatgaactttttattatcatcatggacatgctccaggactcctctctgttggccaaaagg
caggtggctctgtggaccctgggacagttggtggcgagcactggctacgtggtggaaccc
tacaggaagtaccccacattgcttgaggtgctgctgaatttcctgaagactgagcagaac
cagggtacacggcgagaggctatccgtgtgttagggctcttgggggccttggatccctac
aagcacaaagtgaacattggcatgatcgaccagtcccgggatgcttctgctgtcagcctg
tcagaatccaagtcaagtcaggattcctctgactacagcaccagtgagatgctggtcaac
atggggaacttgcctctggacgagttctacccagccgtgtccatggtggccctgatgcgc
atcttccgagaccagtccctctctcaccatcacaccatggtcgtccaggccatcaccttc
atcttcaagtccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattc
ctgaatgtcattcgggtttgtgacggggccatccgggaatttctgttccagcagctggga
atgttggtgtcctttgtgaagagccacatcaggccttacatggatgaaatagtcacactc
atgagagaattctgggtcatgaacacctccatccagagcacgatcattcttctcattgag
cagattgtggtagctcttgggggtgaatttaagctctacctgccccagctgatcccacac
atgctacgagtcttcatgcatgacaatagcccaggccgcatcgtctccatcaagttgctg
gctgcaatccagctgtttggcgccaacctggatgattatctgcatttgttgctgccccct
atcgtgaagttgtttgatgcccccgaggttccattgccgtctcgaaaggcagcgttagag
acagtggaccgcctgacggagtccctggatttcactgactatgcctctcggatcattcac
ccgattgtgcgaacgctggaccagagcccagaactccgtcccacagccatggacacgttg
tcctcactcgtgtttcagctggggaagaagtaccaaattttcattccaatggtaaataaa
gttctggtgcgacaccgaatcaaccatcagcgctacgatgtcctcatctgccggattgtc
aagggatacacccttgctgatgaagaagaggaccctttgatttaccagcatcgaatgctg
cggagtggccaaggggatgccttggctagcggaccagtggaaacaggacccatgaagaaa
ctgcacgtcagcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaa
gatgactggttggaatggctgaggcggctgagcctggagctgctgaaggactcctcctca
ccctccctgcgctcctgctgggccctggcacaggcctacaacccgatggccagggatctc
tttaacgctgcgtttgtgtcctgctggtctgagctgaatgaagaccagcaggatgagctc
atcagaagcatcgagttggccctcacctcccaggacatcgctgaagtcacacaaaccctc
ttaaacttggctgaattcatggaacacagcgacaagggccccctgccattgagagatgac
aatggcattgttctgctgggtgagagggctgccaagtgccgagcatatgccaaagcgcta
cactacaaagaactggagttccagaagggtcccactcctgccatcctagagtctctcatc
agcattaataataagctacagcagccagaggcagctgccggggtattagaatatgccatg
aaacacttcggagagctggagatccaggctacctggtatgagaaactgcatgagtgggag
gatgctcttgtggcctacgataagaaaatggacaccaacaaggatgacccagagctgatg
ctgggccgcatgcgctgcctcgaggccttgggggaatgggggcagctccaccagcagtgc
tgtgaaaagtggaccctggttaatgatgagacccaagccaagatggcccggatggctgct
gcagccgcatggggtttaggtcagtgggacagcatggaggagtacacctgcatgatccct
cgggatacccacgacggggcattttacagagccgtgctggcgctgcatcaggacctcttc
tccttggcgcagcagtgcatcgacaaagcccgggacctgctggacgctgagttaactgcg
atggcaggagagagctacagccgggcgtatggggccatggtttcttgccacatgctgtcc
gagctggaggaggtcatccagtacaaacttgtccccgagcgccgggagatcatccgccag
atctggtgggagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctc
atggtgcggtcgctagtggtcagccctcacgaggacatgaggacctggctcaagtatgca
agcctgtgtggcaagagtggcaggctggctcttgctcataagaccttagtgctgctcctg
ggagttgatccatctcggcaacttgaccaccctctgccaacagttcacccccaggtgacc
tacgcctacatgaaaaatatgtggaagagcgctcgcaagatcgacgccttccagcacatg
cagcacttcgttcagaccgtgcagcagcaggcccagcacgccatcgccactgaggaccag
cagcacaagcaggagctgcacaagcttatggcccgatgtttcctgaaactcggggagtgg
cagctgaacctgcagggcatcaacgagagcacgatccccaaagtcctgcagtattatagc
gccgccacagagcacgaccgcagctggtacaaggcctggcacgcgtgggctgtgatgaac
ttcgaggctgtgctccactacaaacatcagaaccaagcccgcgatgagaagaagaaactg
cgtcacgccagtggggccaacatcaccaacgtggccactgccgccaccacggcggccacg
gccactgccaccagcaccgagggtagtaacagcgagagcgaggctgagagcactgagaac
agccctaccccatctcctctgcagaagaaggtcactgaggatttgtccaaaaccctcttg
atgtacaccgtccctgctgtccagggcttcttccgatccatctctttgtcacgaggcaac
aacctccaggacacgctcagagtcctcaccttatggtttgattatggtcactggccagat
gtaaacgaagccttagtggaaggggtgaaagcgatccagattgacacttggttacaggtt
atacctcagctcattgcgagaattgatacgccgaggcctttggtgggacgtctcattcac
cagcttctcacagacattggtcggtaccacccccaggccctcatctacccgctgacggtg
gcttctaagtctaccaccacggcccgtcacaatgcggccaacaagattctgaagaacatg
tgcgagcacagtaacaccttggtgcaacaggccatgatggtgagtgaggagctgatccga
gtggccattctctggcatgagatgtggcacgaaggcctggaagaggcatctcgcttgtac
tttggggagaggaacgtgaaaggcatgttcgaggtgctggagcccctgcatgctatgatg
gagcggggaccccagactctgaaggaaacatccttcaaccaggcgtatggtcgagattta
atggaggcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacc
caagcctgggacctctattaccacgtgttcagacgaatctcaaagcagctgcctcagctc
acatccttagagctgcaatacgtgtccccaaaacttctgatgtgccgggacctggaactg
gctgtgccgggaacatacgaccccaaccagccgatcattcgcattcagtccattgcacca
tctctacaagtcatcacatccaagcagaggccccggaagttgacgcttatgggcagcaac
gggcacgagtttgtcttcctcctgaagggccatgaagatctgcggcaggacgagcgagtg
atgcagctcttcggcctggtcaacacccttctggccaatgacccaacatctcttcggaaa
aacctcagcatccagagatatgctgtcattcccttatcaaccaattcgggcctcatcggc
tgggtcccccactgtgacacgctgcacgccctcatccgggactacagggagaaaaagaag
atccttctcaacatcgagcatcgcatcatgctgcggatggctccagactacgaccacctg
actctgatgcagaaggtcgaggtgtttgagcacgccgtcaacaacacagctggggacgac
ctggccaggctgctgtggctgaagagccccagctccgaggtgtggtttgatcgaagaacc
aattacacccgttctttagcagtcatgtccatggttgggtatattttgggcctgggcgat
agacacccatccaacctgatgctggaccggctgagcgggaagatcctgcacattgacttt
ggggactgctttgaggttgctatgaccagagagaaattcccagagaagattccgtttaga
ctaacaagaatgttgaccaatgctatggaggtcacgggcctggacggcaactacagaatc
acatgccacacggtgatggaagtgcttcgggagcacaaggacagcgtcatggccgtgctg
gaagccttcgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggc
aacaagcgatcacgaacgaggacagattcctactctgctggccagtcagtagaaattttg
gatggtgtggaacttggggaaccagcccataagaaaacagggaccacagtgccagaatct
attcattctttcattggagacgggttggtgaaaccagaggccctaaataagaaagctatt
cagattattaacagagttcgagataagctcactggtcgggacttctctcacgatgaaaca
ttggatgtcccaacacaagttgagctgctcatcaaacaagcaacatcccatgaaaacctc
tgccagtgctacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system