KEGG   Delphinapterus leucas (beluga whale): 111187347
Entry
111187347         CDS       T05885                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor isoform X1
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04114  Oocyte meiosis
dle04140  Autophagy - animal
dle04144  Endocytosis
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04510  Focal adhesion
dle04520  Adherens junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04730  Long-term depression
dle04913  Ovarian steroidogenesis
dle04914  Progesterone-mediated oocyte maturation
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05205  Proteoglycans in cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111187347 (IGF1R)
   04014 Ras signaling pathway
    111187347 (IGF1R)
   04015 Rap1 signaling pathway
    111187347 (IGF1R)
   04066 HIF-1 signaling pathway
    111187347 (IGF1R)
   04068 FoxO signaling pathway
    111187347 (IGF1R)
   04151 PI3K-Akt signaling pathway
    111187347 (IGF1R)
   04152 AMPK signaling pathway
    111187347 (IGF1R)
   04150 mTOR signaling pathway
    111187347 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111187347 (IGF1R)
   04140 Autophagy - animal
    111187347 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    111187347 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111187347 (IGF1R)
   04520 Adherens junction
    111187347 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    111187347 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    111187347 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    111187347 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    111187347 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    111187347 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    111187347 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187347 (IGF1R)
   05202 Transcriptional misregulation in cancer
    111187347 (IGF1R)
   05205 Proteoglycans in cancer
    111187347 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111187347 (IGF1R)
   05214 Glioma
    111187347 (IGF1R)
   05218 Melanoma
    111187347 (IGF1R)
   05215 Prostate cancer
    111187347 (IGF1R)
   05224 Breast cancer
    111187347 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111187347 (IGF1R)
   01522 Endocrine resistance
    111187347 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111187347 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dle04090]
    111187347 (IGF1R)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111187347 (IGF1R)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   111187347 (IGF1R)
CD molecules [BR:dle04090]
 Proteins
  111187347 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 111187347
NCBI-ProteinID: XP_022454621
UniProt: A0A2Y9QAK7
LinkDB
Position
Unknown
AA seq 1368 aa
MKSGSGGGSPTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENHECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPSCPPNTYRFEGWRCVDRDFCANIPNAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEIVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDILHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKADKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNAIFVPRPERKRREVMQVANTTMSSRNRNTTVVDTYNITDPEELETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVQAKTTYENFIHLIIALPIAVLLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAAR
NCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFG
VVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF
LEIISSIKDEMEPGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSSSLPLPDR
HSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKKERALPLPQSSTC
NT seq 4107 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttttctcc
gccgcgctctcgctctggccgacgagtggagaaatctgtgggccaggcatcgacatccgc
aacgactaccagcagctgaagcggctggagaactgcacggtgatcgagggctacctccac
atcctgctcatttccaaggctgaggactaccgcagctaccgcttccccaagctcacggtc
atcactgagtacctgctgctgttccgcgtggccggcctcgagagcctcggcgacctcttc
cccaacctcacagtcatccgtggctggaagctcttctacaactacgccctggtcatcttc
gagatgaccaacctcaaggatattgggctctacaacctgcgaaacattacccgtggggcc
atccggatcgagaagaatgctgacctctgctacctctccacggtggactggtccctaatc
ctggatgccgtgtccaataactacatcgtgggaaataagcccccaaaggagtgtggggac
ctgtgcccggggacgatggaggagaagccgctgtgcgagaagacgaccatcaacaacgag
tacaactaccgctgctggaccacgaaccgctgtcagaaaatgtgcccgagcacgtgcggg
aagcgggcgtgcacggagaaccacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcccgacaacgacacggcctgcgtggcctgccgccactactactatgccggtgtctgt
gtgcccagctgcccgcccaacacctaccgcttcgagggctggcgttgtgtggaccgtgac
ttctgcgccaacatccccaacgctgagagcagcgattccgagggcttcgtgatccacgac
ggcgagtgcatgcaggagtgcccgtcgggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgcgaaggcccttgtcccaaagtgtgtgaggaagagaaaaagacaaagacc
attgattctgtcacttctgctcagatgctccaaggatgcaccattttcaagggcaatcta
ctcattaatatccggcgcggcaacaacatcgcttcggaactggagaacttcatgggactc
atcgagatcgtgacgggctacgtgaagatccgccactcccatgccttggtctccttgtcc
ttcctgaagaaccttcgccagatcctaggagaggagcaactagaggggaattactccttc
tacgtcctcgacaaccagaacttgcagcagctgtgggactgggaccaccgcaacctgacc
atcaaagccgggaaaatgtactttgctttcaatcccaaattgtgtgtctctgagatttac
cgcatggaggaagtgacggggactaaagggcgccagagcaaaggggacataaacaccagg
aacaacggagagagagcctcctgtgaaagtgacatcctgcacttcacctccaccaccacg
tggaagaaccgcatcatcatcacctggcaccggtaccggccccctgactacagggacctc
atcagcttcaccgtctactacaaggaagcaccctttaaaaacgtcacagagtatgacggg
caggatgcctgtggctccaacagctggaacatggtagatgtggacctcccacccaacaag
gacgtggagcccggcattttactgcatggactgaagccctggacacagtatgccgtttac
gtcaaggctgtgaccctcaccatggtggagaatgaccacatccgtggagccaagagcgag
atcttgtacattcgcaccaatgcttcagttccttccatccccctggatgtactctcagca
tcaaactcctcttctcagctgatcgtgaagtggaaccctccttccctgcccaacggcaac
ctgagctactacatcgtaaggtggcagcgccagccccaggacagctacctttaccggcac
aattactgctccaaagcagacaaaatccccatcaggaagtacgccgatggcaccatcgac
gttgaggaggtgacggagaatcccaagaccgaagtgtgtggtggggagaaagggccgtgc
tgcgcttgccccaaaaccgaagccgagaagcaggccgagaaggaggaggccgagtaccgc
aaggtcttcgagaatttcctgcacaacgccatcttcgtgcccagacctgaacggaagcgg
agggaggtcatgcaggtcgccaacaccaccatgtccagccggaacaggaacaccacggtg
gtggacacctacaacatcacagacccagaggagctcgagaccgagtaccctttcttcgag
agcagagtggataacaaggagagaactgtcatctccaacctccggccttttactctgtac
cgaatcgatatccacagctgtaaccacgaagctgagaagcttggctgcagcgcctccaac
tttgtctttgcaagaaccatgcctgcagaaggagcagatgacattcctgggccagtgacc
tgggagccaaggcctgagaactccatctttttaaaatggccagaacctgagaatcccaat
ggattgattttaatgtatgaaataaaatatggatcacaagtcgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtatggaggggccaagctaaaccggctcaacccgggg
aactacacggcccggatccaggccacctctctctctgggaacgggtcatggactgatcct
gtgttcttctatgtccaggccaaaacaacgtatgaaaacttcatccatctgatcattgct
ctgcccattgccgttctgctgatagtaggagggttggttataatgctgtacgtcttccat
agaaaaagaaataacagcaggctggggaacggagtgctgtatgcctctgtgaacccggag
tacttcagtgcagccgatgtgtacgtgcctgacgagtgggaggtcgcccgggagaagatc
accatgagccgggagctggggcagggctcgttcgggatggtttatgaaggtgtcgccaag
ggcgtggtcaaggatgagcctgagaccagggtggccattaagacggtgaacgaagccgcc
agcatgcgcgagaggattgagtttctcaacgaggcctcggtgatgaaggagttcaactgt
caccatgtggtgcgcttgctgggcgtggtgtcccagggccagccgacgctggtcatcatg
gaactgatgacccggggggacctcaaaagttatctccggtctctgaggccagaaatggag
aataatccagtcctagcacctcccagcctaagcaaaatgatccagatggctggagagatt
gcagatggcatggcatacctcaacgccaataagtttgtccacagagacctcgctgcccgg
aactgcatggtggccgaagatttcacagtcaaaatcggagattttgggatgacgagagac
atctatgagaccgactattaccggaagggagggaaggggctgctgcccgtgcgctggatg
tcccccgagtccctcaaggatggagtcttcaccacgcactctgacgtctggtccttcggg
gtcgtcctctgggagatcgccacgctggccgagcagccataccagggcctgtccaatgag
caagtccttcgctttgtcatggagggcggccttctggacaagccggacaactgtcctgac
atgctgtttgaactgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttc
ctggaaatcatcagcagcatcaaggacgagatggagcccggcttccgggaggtctccttc
tactacagcgaggagaacaagccacctgagccagaggagctggacctagagccggagaac
atggagagtgtccccttggacccctcggcatcctcgtcctccctgccactgcccgacaga
cactcaggacacaaggccgagaacggtccgggccctggcgtgctggtccttcgagccagc
ttcgacgagagacagccttatgcgcacatgaacgggggccgcaagaaggagcgggccttg
cctctgccccagtcctcaacctgctga

DBGET integrated database retrieval system