KEGG   Delphinapterus leucas (beluga whale): 111187597
Entry
111187597         CDS       T05885                                 

Gene name
CXCL10
Definition
(RefSeq) C-X-C motif chemokine 10
  KO
K12671  C-X-C motif chemokine 10
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04062  Chemokine signaling pathway
dle04620  Toll-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04623  Cytosolic DNA-sensing pathway
dle04657  IL-17 signaling pathway
dle04668  TNF signaling pathway
dle05160  Hepatitis C
dle05164  Influenza A
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111187597 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111187597 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111187597 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111187597 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    111187597 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    111187597 (CXCL10)
   04657 IL-17 signaling pathway
    111187597 (CXCL10)
   04062 Chemokine signaling pathway
    111187597 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    111187597 (CXCL10)
   05171 Coronavirus disease - COVID-19
    111187597 (CXCL10)
   05164 Influenza A
    111187597 (CXCL10)
   05169 Epstein-Barr virus infection
    111187597 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111187597 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111187597 (CXCL10)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Chemokines
   111187597 (CXCL10)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Chemokines
   111187597 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 111187597
NCBI-ProteinID: XP_022455139
UniProt: A0A2Y9Q7R7
LinkDB
Position
Unknown
AA seq 103 aa
MNQSAVLIFCLILLTLRGTQEIPLSRTTRCTCIKISDRPVNPRSLEKLEVIPASQSCPRV
EIIATMKKNGEKRCLNPESKTIKNLLKAISKERSKRSQTQKEA
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaaccaaagtgctgttcttattttctgccttatccttctgactctgagaggaactcaa
gaaatacctctctctaggactacacgctgtacgtgtatcaagatcagcgatcgacctgtt
aatccaaggtccttagaaaaacttgaagtgattcctgcaagtcaatcttgcccacgtgtt
gagatcattgccacaatgaaaaagaacggggagaaaagatgtcttaatccagagtctaag
accatcaagaatttactgaaagcaattagcaaggaaaggtctaaaagatctcaaacacag
aaagaggcataa

DBGET integrated database retrieval system