Delphinapterus leucas (beluga whale): 111187597 Help Entry 111187597         CDS       T05885                                  Gene name CXCL10 Definition (RefSeq) C-X-C motif chemokine 10   KO K12671   C-X-C motif chemokine 10 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04060   Cytokine-cytokine receptor interaction dle04061   Viral protein interaction with cytokine and cytokine receptor dle04062   Chemokine signaling pathway dle04620   Toll-like receptor signaling pathway dle04622   RIG-I-like receptor signaling pathway dle04623   Cytosolic DNA-sensing pathway dle04657   IL-17 signaling pathway dle04668   TNF signaling pathway dle05160   Hepatitis C dle05164   Influenza A dle05169   Epstein-Barr virus infection dle05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     111187597 (CXCL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111187597 (CXCL10)    04061 Viral protein interaction with cytokine and cytokine receptor     111187597 (CXCL10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111187597 (CXCL10)    04622 RIG-I-like receptor signaling pathway     111187597 (CXCL10)    04623 Cytosolic DNA-sensing pathway     111187597 (CXCL10)    04657 IL-17 signaling pathway     111187597 (CXCL10)    04062 Chemokine signaling pathway     111187597 (CXCL10)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     111187597 (CXCL10)    05171 Coronavirus disease - COVID-19     111187597 (CXCL10)    05164 Influenza A     111187597 (CXCL10)    05169 Epstein-Barr virus infection     111187597 (CXCL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:dle04052]     111187597 (CXCL10)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111187597 (CXCL10) Cytokines and growth factors [BR:dle04052]  Cytokines   Chemokines    111187597 (CXCL10) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Heparin   Chemokines    111187597 (CXCL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  111187597 NCBI-ProteinID:  XP_022455139 UniProt:  A0A2Y9Q7R7 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNQSAVLIFCLILLTLRGTQEIPLSRTTRCTCIKISDRPVNPRSLEKLEVIPASQSCPRV EIIATMKKNGEKRCLNPESKTIKNLLKAISKERSKRSQTQKEA NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaaccaaagtgctgttcttattttctgccttatccttctgactctgagaggaactcaa gaaatacctctctctaggactacacgctgtacgtgtatcaagatcagcgatcgacctgtt aatccaaggtccttagaaaaacttgaagtgattcctgcaagtcaatcttgcccacgtgtt gagatcattgccacaatgaaaaagaacggggagaaaagatgtcttaatccagagtctaag accatcaagaatttactgaaagcaattagcaaggaaaggtctaaaagatctcaaacacag aaagaggcataa

DBGET integrated database retrieval system