KEGG   Delphinapterus leucas (beluga whale): 111187609
Entry
111187609         CDS       T05885                                 

Gene name
EREG
Definition
(RefSeq) proepiregulin
  KO
K09784  epiregulin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04151  PI3K-Akt signaling pathway
dle05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111187609 (EREG)
   04012 ErbB signaling pathway
    111187609 (EREG)
   04151 PI3K-Akt signaling pathway
    111187609 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    111187609 (EREG)
SSDB
Motif
Pfam: EGF Sec66 Insulin_TMD DUF2207
Other DBs
NCBI-GeneID: 111187609
NCBI-ProteinID: XP_022455146
UniProt: A0A2Y9QC21
LinkDB
Position
Unknown
AA seq 265 aa
MTSGQSSGHSSPGGDYETPDTQLVLSPQAPPRTYKGLGAGCGVHLPYRPGVGGKSCRRVD
PAAPIAPAAATATAASAAAPPVPARPPPRPRPRPAHADAGRRMEPRRARWVPAPLLCLGF
HLLQAVLSTTVIPSCIPGESEDNCTALVQTEDNPRVAQVSISKCSSDMNGYCFHGQCIYL
VDMSENHCRCEVGYTGVRCEHFFLTVQKPLSKEYVALTVILVILFLVVVAGSVYYFCRWY
RYRKSKEPKKEYERVTSGDPALPQV
NT seq 798 nt   +upstreamnt  +downstreamnt
atgacatccggacagtcctccggccactcctcccccgggggcgattatgaaactccggac
acgcagttagtcctcagtccccaggccccgccccgtacttataaaggtctcggcgcgggc
tgtggagttcacttgccctacagaccgggtgtcggagggaaaagctgccgacgcgtggac
cccgcagctcccatagcgcccgccgccgccaccgccaccgccgcctccgcagcagcccct
ccggtccccgcccgcccgccgcccaggccacgcccgcgccccgcacacgctgacgcgggg
aggaggatggagccgcgccgtgcccgctgggtccccgcgccgctgctctgcctgggtttc
catcttctacaagcagttctcagtacaactgtgattccttcatgtatcccaggagagtcc
gaagataactgcacagctttagttcagacagaagataatccacgtgtggctcaagtgtca
atatcaaagtgtagctctgacatgaacggctactgttttcatggacagtgcatctacctg
gtagacatgagtgaaaatcactgcaggtgtgaagtgggttacactggtgtccgatgtgag
cacttctttttaaccgtccaaaagcctctgagcaaagaatatgtggctttgactgtgatt
cttgttatcttgttcctcgtcgtagttgctggctctgtatactatttctgcagatggtac
agatatcgaaaaagtaaagaaccaaagaaggaatatgaaagagtgacctcaggggatcca
gcattgccacaagtctga

DBGET integrated database retrieval system